Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CDCP1Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CDCP1 Polyclonal Antibody | anti-CDCP1 antibody

CDCP1 Antibody - C-terminal region

Gene Names
CDCP1; CD318; TRASK; SIMA135
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CDCP1; Polyclonal Antibody; CDCP1 Antibody - C-terminal region; anti-CDCP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ICCVKKKKKKTNKGPAVGIYNDNINTEMPRQPKKFQKGRKDNDSHVYAVI
Sequence Length
649
Applicable Applications for anti-CDCP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CDCP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CDCP1Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CDCP1Sample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CDCP1 antibody
This is a rabbit polyclonal antibody against CDCP1. It was validated on Western Blot

Target Description: This gene encodes a transmembrane protein which contains three extracellular CUB domains and acts as a substrate for Src family kinases. The protein plays a role in the tyrosine phosphorylation-dependent regulation of cellular events that are involved in tumor invasion and metastasis. Alternative splicing results in multiple transcript variants of this gene.
Product Categories/Family for anti-CDCP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71kDa
NCBI Official Full Name
CUB domain-containing protein 1 isoform 1
NCBI Official Synonym Full Names
CUB domain containing protein 1
NCBI Official Symbol
CDCP1
NCBI Official Synonym Symbols
CD318; TRASK; SIMA135
NCBI Protein Information
CUB domain-containing protein 1
UniProt Protein Name
CUB domain-containing protein 1
UniProt Gene Name
CDCP1
UniProt Synonym Gene Names
TRASK; SIMA135
UniProt Entry Name
CDCP1_HUMAN

NCBI Description

This gene encodes a transmembrane protein which contains three extracellular CUB domains and acts as a substrate for Src family kinases. The protein plays a role in the tyrosine phosphorylation-dependent regulation of cellular events that are involved in tumor invasion and metastasis. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013]

Uniprot Description

CDCP1: a transmembrane protein containing three extracellular CUB domains involved in cell adhesion and cell matrix association. May play a role in the regulation of anchorage versus migration or proliferation versus differentiation depending upon its phosphorylation status. Interacts with N- and P-cadherin, syndecans 1 and 4, the serine protease ST14, SRC and PKCG. Highly expressed in mitotic cells with low expression during interphase. Detected at highest levels in skeletal muscle and colon with lower levels in kidney, small intestine, placenta and lung. Up-regulated in a number of human tumor cell lines, as well as in colorectal cancer, breast carcinoma and lung cancer. Its expression level is correlated with the metastatic ability of carcinoma cells. May be a novel marker for leukemia diagnosis and for immature hematopoietic stem cell subsets. Belongs to the tetraspanin web involved in tumor progression and metastasis. Also expressed in cells with phenotypes reminiscent of mesenchymal stem cells and neural stem cells. Three alternatively spliced human isoforms have been reported. Isoform 1 is a single-pass membrane protein that may also be shed, giving rise to a soluble peptide. Isoform 3 is secreted.

Protein type: Membrane protein, integral; Cell surface

Chromosomal Location of Human Ortholog: 3p21.31

Molecular Function: protein binding

Research Articles on CDCP1

Similar Products

Product Notes

The CDCP1 cdcp1 (Catalog #AAA3219419) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDCP1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDCP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDCP1 cdcp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ICCVKKKKKK TNKGPAVGIY NDNINTEMPR QPKKFQKGRK DNDSHVYAVI. It is sometimes possible for the material contained within the vial of "CDCP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.