Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CDC42EP2 expression in transfected 293T cell line by CDC42EP2 MaxPab polyclonal antibody.Lane 1: CDC42EP2 transfected lysate(22.50 KDa).Lane 2: Non-transfected lysate.)

Rabbit anti-Human CDC42EP2 Polyclonal Antibody | anti-CDC42EP2 antibody

CDC42EP2 (CDC42 Effector Protein (Rho GTPase Binding) 2, BORG1, CEP2) (Biotin)

Gene Names
CDC42EP2; CEP2; BORG1
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
CDC42EP2; Polyclonal Antibody; CDC42EP2 (CDC42 Effector Protein (Rho GTPase Binding) 2; BORG1; CEP2) (Biotin); CDC42 Effector Protein (Rho GTPase Binding) 2; CEP2; anti-CDC42EP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CDC42EP2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CDC42EP2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CDC42EP2 (NP_006770.1, 1aa-210aa) full-length human protein.
Immunogen Sequence
MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGSDMFGDISFLQGKFHLLPGTMVEGPEEDGTFDLPFQFTRTATVCGRELPDGPSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CDC42EP2 expression in transfected 293T cell line by CDC42EP2 MaxPab polyclonal antibody.Lane 1: CDC42EP2 transfected lysate(22.50 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CDC42EP2 expression in transfected 293T cell line by CDC42EP2 MaxPab polyclonal antibody.Lane 1: CDC42EP2 transfected lysate(22.50 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-CDC42EP2 antibody
CDC42, a small Rho GTPase, regulates the formation of F-actin-containing structures through its interaction with the downstream effector proteins. The protein encoded by this gene is a member of the Borg family of CDC42 effector proteins. Borg family proteins contain a CRIB (Cdc42/Rac interactive-binding) domain. They bind to, and negatively regulate the function of, CDC42. Coexpression of this protein with dominant negative mutant CDC42 protein in fibroblast was found to induce pseudopodia formation, which suggested a role of this protein in actin filament assembly and cell shape control. [provided by RefSeq]
Product Categories/Family for anti-CDC42EP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22,484 Da
NCBI Official Full Name
cdc42 effector protein 2
NCBI Official Synonym Full Names
CDC42 effector protein (Rho GTPase binding) 2
NCBI Official Symbol
CDC42EP2
NCBI Official Synonym Symbols
CEP2; BORG1
NCBI Protein Information
cdc42 effector protein 2; binder of Rho GTPases 1; CRIB-containing BOGR1 protein
UniProt Protein Name
Cdc42 effector protein 2
Protein Family
UniProt Gene Name
CDC42EP2
UniProt Synonym Gene Names
BORG1; CEP2
UniProt Entry Name
BORG1_HUMAN

NCBI Description

CDC42, a small Rho GTPase, regulates the formation of F-actin-containing structures through its interaction with the downstream effector proteins. The protein encoded by this gene is a member of the Borg family of CDC42 effector proteins. Borg family proteins contain a CRIB (Cdc42/Rac interactive-binding) domain. They bind to, and negatively regulate the function of CDC42. Coexpression of this protein with CDC42 suggested a role of this protein in actin filament assembly and cell shape control. [provided by RefSeq, Aug 2011]

Uniprot Description

CDC42EP2: Probably involved in the organization of the actin cytoskeleton. May act downstream of CDC42 to induce actin filament assembly leading to cell shape changes. Induces pseudopodia formation in fibroblasts in a CDC42-dependent manner. Belongs to the BORG/CEP family.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: microtubule cytoskeleton; membrane; cytoplasm; plasma membrane; endomembrane system

Molecular Function: protein binding; opioid peptide activity; GTP-Rho binding

Biological Process: regulation of cell shape; positive regulation of pseudopodium formation; positive regulation of protein complex assembly; positive regulation of actin filament polymerization; actin filament organization; actin cytoskeleton organization and biogenesis

Research Articles on CDC42EP2

Similar Products

Product Notes

The CDC42EP2 cdc42ep2 (Catalog #AAA6450653) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDC42EP2 (CDC42 Effector Protein (Rho GTPase Binding) 2, BORG1, CEP2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDC42EP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDC42EP2 cdc42ep2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDC42EP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.