Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CDC27Sample Tissue: Human K562 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CDC27 Polyclonal Antibody | anti-CDC27 antibody

CDC27 Antibody - C-terminal region

Gene Names
CDC27; APC3; HNUC; NUC2; H-NUC; ANAPC3; CDC27Hs; D0S1430E; D17S978E
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CDC27; Polyclonal Antibody; CDC27 Antibody - C-terminal region; anti-CDC27 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESD
Sequence Length
824
Applicable Applications for anti-CDC27 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CDC27
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CDC27Sample Tissue: Human K562 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CDC27Sample Tissue: Human K562 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CDC27 antibody
The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae protein Cdc27, and the gene product of Schizosaccharomyces pombe nuc 2. This protein is a component of the anaphase-promoting complex (APC), which is composed of eight protein subunits and is highly conserved in eukaryotic cells. This complex catalyzes the formation of cyclin B-ubiquitin conjugate, which is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. The protein encoded by this gene and three other members of the APC complex contain tetratricopeptide (TPR) repeats, which are important for protein-protein interactions. This protein was shown to interact with mitotic checkpoint proteins including Mad2, p55CDC and BUBR1, and it may thus be involved in controlling the timing of mitosis. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 2, 22 and Y.
Product Categories/Family for anti-CDC27 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
996
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90 kDa
NCBI Official Full Name
cell division cycle protein 27 homolog isoform 1
NCBI Official Synonym Full Names
cell division cycle 27
NCBI Official Symbol
CDC27
NCBI Official Synonym Symbols
APC3; HNUC; NUC2; H-NUC; ANAPC3; CDC27Hs; D0S1430E; D17S978E
NCBI Protein Information
cell division cycle protein 27 homolog
UniProt Protein Name
Cell division cycle protein 27 homolog
UniProt Gene Name
CDC27
UniProt Synonym Gene Names
ANAPC3; D0S1430E; D17S978E; APC3; CDC27Hs
UniProt Entry Name
CDC27_HUMAN

NCBI Description

The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae protein Cdc27, and the gene product of Schizosaccharomyces pombe nuc 2. This protein is a component of the anaphase-promoting complex (APC), which is composed of eight protein subunits and is highly conserved in eukaryotic cells. This complex catalyzes the formation of cyclin B-ubiquitin conjugate, which is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. The protein encoded by this gene and three other members of the APC complex contain tetratricopeptide (TPR) repeats, which are important for protein-protein interactions. This protein was shown to interact with mitotic checkpoint proteins including Mad2, p55CDC and BUBR1, and it may thus be involved in controlling the timing of mitosis. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 2, 22 and Y. [provided by RefSeq, May 2014]

Uniprot Description

CDC27: Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. The APC/C is composed of at least 12 subunits. Interacts with RB. Interacts with FAM168B/MANI. Belongs to the APC3/CDC27 family.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 17q21.32

Cellular Component: nucleoplasm; centrosome; anaphase-promoting complex; spindle microtubule; cytoplasm; spindle; nucleus; cytosol

Molecular Function: protein binding; protein phosphatase binding

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; cell proliferation; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; mitotic cell cycle spindle assembly checkpoint; mitotic cell cycle; mitotic metaphase/anaphase transition

Research Articles on CDC27

Similar Products

Product Notes

The CDC27 cdc27 (Catalog #AAA3224058) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDC27 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDC27 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDC27 cdc27 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NQIKEAIDKR YLPDDEEPIT QEEQIMGTDE SQESSMTDAD DTQLHAAESD. It is sometimes possible for the material contained within the vial of "CDC27, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.