Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human CDC25C Polyclonal Antibody | anti-CDC25C antibody

CDC25C (Cell Division Cycle 25 Homolog C, Cdc 25C, CDC 25, Dual Specificity Phosphatase Cdc25C, M-phase Inducer Phosphatase 3, MPIP3, PPP1R60) (MaxLight 405)

Gene Names
CDC25C; CDC25; PPP1R60
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CDC25C; Polyclonal Antibody; CDC25C (Cell Division Cycle 25 Homolog C; Cdc 25C; CDC 25; Dual Specificity Phosphatase Cdc25C; M-phase Inducer Phosphatase 3; MPIP3; PPP1R60) (MaxLight 405); anti-CDC25C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CDC25C.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-CDC25C antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CDC25C, aa1-473 (AAH19089.1).
Immunogen Sequence
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQDLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKKPIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFFPEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
Conjugate
MaxLight405
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-CDC25C antibody
Cdc25C is a tyrosine protein phosphatase required for progression of the cell cycle. Cdc25C activates cell cycle-specific cyclin-dependent kinases (CDKs), including cdc2, via dephosphorylation events. Cdc25C is activated via phosphorylation at Ser216. In response to DNA damage and DNA replicational stress, Chk1 and Chk2 phosphorylate Cdc25C to prevent entry into mitosis.
Product Categories/Family for anti-CDC25C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
995
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
45,608 Da
NCBI Official Full Name
Cell division cycle 25 homolog C (S. pombe)
NCBI Official Synonym Full Names
cell division cycle 25C
NCBI Official Symbol
CDC25C
NCBI Official Synonym Symbols
CDC25; PPP1R60
NCBI Protein Information
M-phase inducer phosphatase 3; mitosis inducer CDC25; phosphotyrosine phosphatase; dual specificity phosphatase CDC25C; protein phosphatase 1, regulatory subunit 60

NCBI Description

This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It is also thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known. [provided by RefSeq, Jul 2008]

Research Articles on CDC25C

Similar Products

Product Notes

The CDC25C (Catalog #AAA6373438) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDC25C (Cell Division Cycle 25 Homolog C, Cdc 25C, CDC 25, Dual Specificity Phosphatase Cdc25C, M-phase Inducer Phosphatase 3, MPIP3, PPP1R60) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDC25C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CDC25C for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CDC25C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.