Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of Cdc25C expression in HELA whole cell lysates (lane 1), SW620 whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). Cdc25C at 53KD was detected using rabbit anti- Cdc25C Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

anti-Human Cdc25C Polyclonal Antibody | anti-CDC25C antibody

Anti-Cdc25C Antibody

Gene Names
CDC25C; CDC25; PPP1R60
Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Cdc25C; Polyclonal Antibody; Anti-Cdc25C Antibody; M-phase inducer phosphatase 3; CDC 25; Cdc 25C; CDC25; CDC25C; Cell division cycle 25 homolog C; Cell division cycle 25C; Cell division cycle 25C protein; Dual specificity phosphatase Cdc25C; M phase inducer phosphatase 3; Mitosis inducer CDC25; MPIP3; MPIP3_HUMAN; Phosphotyrosine phosphatase; PPP1R60; protein phosphatase 1; regulatory subunit 60; cell division cycle 25C; anti-CDC25C antibody
Ordering
For Research Use Only!
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
473
Applicable Applications for anti-CDC25C antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Cdc25C (435-473aa MHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP), different from the related mouse sequence by ten amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of Cdc25C expression in HELA whole cell lysates (lane 1), SW620 whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). Cdc25C at 53KD was detected using rabbit anti- Cdc25C Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of Cdc25C expression in HELA whole cell lysates (lane 1), SW620 whole cell lysates (lane 2) and MCF-7 whole cell lysates (lane 3). Cdc25C at 53KD was detected using rabbit anti- Cdc25C Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-CDC25C antibody
Description: Rabbit IgG polyclonal antibody for M-phase inducer phosphatase 3(CDC25C) detection. Tested with WB in Human.

Background: M-phase inducer phosphatase 3 is an enzyme that in humans is encoded by the CDC25C gene. This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 (CDK1) and triggers entry into mitosis. Also, it is thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.
References
1. "Entrez Gene: CDC25C cell division cycle 25 homolog C (S. pombe)". 2. Gould KL, Moreno S, Tonks NK, Nurse P (Feb 1991). "Complementation of the mitotic activator, p80cdc25, by a human protein-tyrosine phosphatase". Science 250 (4987): 1573-6. 3. Sartor H, Ehlert F, Grzeschik KH, et al. (1992). "Assignment of two human cell cycle genes, CDC25C and CCNB1, to 5q31 and 5q12, respectively". Genomics 13(3): 911-2.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
995
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,608 Da
NCBI Official Full Name
M-phase inducer phosphatase 3 isoform a
NCBI Official Synonym Full Names
cell division cycle 25C
NCBI Official Symbol
CDC25C
NCBI Official Synonym Symbols
CDC25; PPP1R60
NCBI Protein Information
M-phase inducer phosphatase 3
UniProt Protein Name
M-phase inducer phosphatase 3
UniProt Gene Name
CDC25C
UniProt Entry Name
MPIP3_HUMAN

NCBI Description

This gene encodes a conserved protein that plays a key role in the regulation of cell division. The encoded protein directs dephosphorylation of cyclin B-bound CDC2 and triggers entry into mitosis. It also suppresses p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described. [provided by RefSeq, Dec 2015]

Uniprot Description

CDC25C: a member of the MPI phosphatase family. Activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. Shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined. At least four transcript variants for this gene exist. Three splice variant isoforms have been described.

Protein type: Motility/polarity/chemotaxis; Protein phosphatase, dual-specificity; EC 3.1.3.48

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: cytosol; nucleoplasm; nucleus; perinuclear region of cytoplasm

Molecular Function: phosphoprotein phosphatase activity; protein binding; protein kinase binding; protein tyrosine phosphatase activity; WW domain binding

Biological Process: cell division; cell proliferation; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; DNA replication; G2/M transition of mitotic cell cycle; mitosis; regulation of cell cycle; regulation of cyclin-dependent protein kinase activity; regulation of mitosis; spermatogenesis; viral reproduction

Research Articles on CDC25C

Similar Products

Product Notes

The CDC25C cdc25c (Catalog #AAA178367) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Cdc25C Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Cdc25C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the CDC25C cdc25c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cdc25C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.