Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MPIP2Sample Type: MDA-MB-435s Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CDC25B Polyclonal Antibody | anti-CDC25B antibody

CDC25B Antibody - C-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CDC25B; Polyclonal Antibody; CDC25B Antibody - C-terminal region; anti-CDC25B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPP
Sequence Length
580
Applicable Applications for anti-CDC25B antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MPIP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MPIP2Sample Type: MDA-MB-435s Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MPIP2Sample Type: MDA-MB-435s Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CDC25B antibody
This is a rabbit polyclonal antibody against MPIP2. It was validated on Western Blot

Target Description: CDC25B is a member of the CDC25 family of phosphatases. CDC25B activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. CDC25B shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined. Multiple transcript variants for this gene exist.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
994
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
M-phase inducer phosphatase 2 isoform 1
NCBI Official Synonym Full Names
cell division cycle 25B
NCBI Official Symbol
CDC25B
NCBI Protein Information
M-phase inducer phosphatase 2
UniProt Protein Name
M-phase inducer phosphatase 2
UniProt Gene Name
CDC25B
UniProt Synonym Gene Names
CDC25HU2
UniProt Entry Name
MPIP2_HUMAN

NCBI Description

CDC25B is a member of the CDC25 family of phosphatases. CDC25B activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. CDC25B shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined. Multiple transcript variants for this gene exist. [provided by RefSeq, Jul 2008]

Uniprot Description

CDC25B: a member of the MPI phosphatase family. Activates the cyclin dependent kinase CDC2 by removing two phosphate groups and it is required for entry into mitosis. Shuttles between the nucleus and the cytoplasm due to nuclear localization and nuclear export signals. The protein is nuclear in the M and G1 phases of the cell cycle and moves to the cytoplasm during S and G2. CDC25B has oncogenic properties, although its role in tumor formation has not been determined. At least four transcript variants for this gene exist. Three splice variant isoforms have been described.

Protein type: EC 3.1.3.48; Nuclear receptor co-regulator; Protein phosphatase, dual-specificity; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 20p13

Cellular Component: nucleoplasm; spindle pole; centrosome; cytoplasm; cytosol

Molecular Function: protein binding; protein tyrosine phosphatase activity; protein kinase binding

Biological Process: positive regulation of cytokinesis; mitosis; cell division; positive regulation of protein kinase activity; positive regulation of cell proliferation; mitotic cell cycle; G2/M transition of mitotic cell cycle; positive regulation of mitotic cell cycle; protein amino acid phosphorylation; oocyte maturation; female meiosis I

Research Articles on CDC25B

Similar Products

Product Notes

The CDC25B cdc25b (Catalog #AAA3219473) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDC25B Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CDC25B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDC25B cdc25b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DLVMYSKCQR LFRSPSMPCS VIRPILKRLE RPQDRDTPVQ NKRRRSVTPP. It is sometimes possible for the material contained within the vial of "CDC25B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.