Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CDC20Sample Tissue: Mouse Stomach lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse CDC20 Polyclonal Antibody | anti-CDC20 antibody

CDC20 Antibody - N-terminal region

Gene Names
Cdc20; C87100; p55CDC; 2310042N09Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
CDC20; Polyclonal Antibody; CDC20 Antibody - N-terminal region; anti-CDC20 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KEATGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRFIPQ
Sequence Length
499
Applicable Applications for anti-CDC20 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse CDC20
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CDC20Sample Tissue: Mouse Stomach lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CDC20Sample Tissue: Mouse Stomach lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CDC20 antibody
Required for full ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. Is regulated by MAD2L1: in metaphase the MAD2L1-CDC20-APC/C ternary complex is inactive and in anaphase the CDC20-APC/C binary complex is active in degrading substrates. The CDC20-APC/C complex positively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 induces presynaptic differentiation.
Product Categories/Family for anti-CDC20 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54 kDa
NCBI Official Full Name
cell division cycle protein 20 homolog
NCBI Official Synonym Full Names
cell division cycle 20
NCBI Official Symbol
Cdc20
NCBI Official Synonym Symbols
C87100; p55CDC; 2310042N09Rik
NCBI Protein Information
cell division cycle protein 20 homolog
UniProt Protein Name
Cell division cycle protein 20 homolog
UniProt Gene Name
Cdc20
UniProt Synonym Gene Names
mmCdc20
UniProt Entry Name
CDC20_MOUSE

Uniprot Description

CDC20: Required for full ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. Is regulated by MAD2L1: in metaphase the MAD2L1-CDC20-APC/C ternary complex is inactive and in anaphase the CDC20-APC/C binary complex is active in degrading substrates. The CDC20-APC/C complex positively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 induces presynaptic differentiation. Found in a complex with CDC20, CDC27, SPATC1 and TUBG1. Interacts with SPATC1. Interacts with NEUROD2. Interacts with MAD2L1 and BUB1B. The phosphorylated form interacts with APC/C. Interacts with NINL. May interact with MAD2L2. Interacts with CDK5RAP2. Interacts with isoform 1 of NEK2. Belongs to the WD repeat CDC20/Fizzy family.

Protein type: Cell cycle regulation; Ubiquitin conjugating system

Cellular Component: nucleoplasm; centrosome; anaphase-promoting complex; cytoskeleton; protein complex; perinuclear region of cytoplasm; cytoplasm; nucleus

Molecular Function: protein C-terminus binding; protein binding; enzyme binding; histone deacetylase binding

Biological Process: mitosis; nervous system development; anaphase-promoting complex activation; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; cell division; positive regulation of cell proliferation; positive regulation of synaptic plasticity; regulation of meiosis; regulation of dendrite development; cell differentiation; cell cycle

Research Articles on CDC20

Similar Products

Product Notes

The CDC20 cdc20 (Catalog #AAA3223598) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDC20 Antibody - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CDC20 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDC20 cdc20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KEATGPAPSP MRAANRSHSA GRTPGRTPGK SSSKVQTTPS KPGGDRFIPQ. It is sometimes possible for the material contained within the vial of "CDC20, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.