Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CDC16Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlCDC16 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Rabbit CDC16 Polyclonal Antibody | anti-CDC16 antibody

CDC16 Antibody - N-terminal region

Gene Names
CDC16; APC6; CUT9; ANAPC6; CDC16Hs
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CDC16; Polyclonal Antibody; CDC16 Antibody - N-terminal region; anti-CDC16 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QALDVLDMEEPINKRLFEKYLKDESGFKDPSSDWEMSQSSIKSSICLLRG
Sequence Length
568
Applicable Applications for anti-CDC16 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Pig: 93%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CDC16
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CDC16Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlCDC16 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (Host: RabbitTarget Name: CDC16Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlCDC16 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-CDC16 antibody
This is a rabbit polyclonal antibody against CDC16. It was validated on Western Blot

Target Description: This gene encodes a component protein of the APC complex, which is composed of eight proteins and functions as a protein ubiquitin ligase. The APC complex is a cyclin degradation system that governs exit from mitosis. Each component protein of the APC complex is highly conserved among eukaryotic organisms. This protein and two other APC complex proteins, CDC23 and CDC27, contain a tetratricopeptide repeat (TPR), a protein domain that may be involved in protein-protein interaction. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Product Categories/Family for anti-CDC16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
cell division cycle protein 16 homolog isoform 1
NCBI Official Synonym Full Names
cell division cycle 16
NCBI Official Symbol
CDC16
NCBI Official Synonym Symbols
APC6; CUT9; ANAPC6; CDC16Hs
NCBI Protein Information
cell division cycle protein 16 homolog
UniProt Protein Name
Cell division cycle protein 16 homolog
UniProt Gene Name
CDC16
UniProt Synonym Gene Names
ANAPC6; APC6; CDC16Hs
UniProt Entry Name
CDC16_HUMAN

NCBI Description

The protein encoded by this gene functions as a protein ubiquitin ligase and is a component of the multiprotein APC complex. The APC complex is a cyclin degradation system that governs exit from mitosis by targeting cell cycle proteins for degredation by the 26S proteasome. Each component protein of the APC complex is highly conserved among eukaryotic organisms. This protein, and other APC complex proteins, contain a tetratricopeptide repeat (TPR) domain; a protein domain that is often involved in protein-protein interactions and the assembly of multiprotein complexes. Multiple alternatively spliced transcript variants, encoding distinct proteins, have been identified. [provided by RefSeq, Jan 2016]

Uniprot Description

CDC16: Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. The APC/C is composed of at least 12 subunits. Interacts with PPP5C and CDC20. Belongs to the APC6/CDC16 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 13q34

Cellular Component: nucleoplasm; centrosome; anaphase-promoting complex; spindle microtubule; cytoplasm; spindle; cytosol

Molecular Function: protein binding

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; cell proliferation; mitosis; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; cell division; mitotic cell cycle spindle assembly checkpoint; regulation of mitosis; mitotic cell cycle

Research Articles on CDC16

Similar Products

Product Notes

The CDC16 cdc16 (Catalog #AAA3214255) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDC16 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CDC16 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDC16 cdc16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QALDVLDMEE PINKRLFEKY LKDESGFKDP SSDWEMSQSS IKSSICLLRG. It is sometimes possible for the material contained within the vial of "CDC16, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.