Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CD86 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)

Rabbit anti-Human, Pig CD86 Polyclonal Antibody | anti-CD86 antibody

CD86 antibody - C-terminal region

Gene Names
CD86; B70; B7-2; B7.2; LAB72; CD28LG2
Reactivity
Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD86; Polyclonal Antibody; CD86 antibody - C-terminal region; anti-CD86 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DVTSNMTIFCILETDKTRLLSSPFSIGTNTMEREESEQTKKREKIHIPER
Sequence Length
275
Applicable Applications for anti-CD86 antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CD86 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)

Western Blot (WB) (WB Suggested Anti-CD86 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)
Related Product Information for anti-CD86 antibody
This is a rabbit polyclonal antibody against CD86. It was validated on Western Blot

Target Description: This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Alternative splicing results in several transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
942
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
T-lymphocyte activation antigen CD86 isoform 3
NCBI Official Synonym Full Names
CD86 molecule
NCBI Official Symbol
CD86
NCBI Official Synonym Symbols
B70; B7-2; B7.2; LAB72; CD28LG2
NCBI Protein Information
T-lymphocyte activation antigen CD86
UniProt Protein Name
T-lymphocyte activation antigen CD86
UniProt Gene Name
CD86
UniProt Synonym Gene Names
CD28LG2
UniProt Entry Name
CD86_HUMAN

NCBI Description

This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Alternative splicing results in several transcript variants encoding different isoforms.[provided by RefSeq, May 2011]

Uniprot Description

CD86: Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T- cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Immunoglobulin superfamily; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q21

Cellular Component: cell surface; intracellular membrane-bound organelle; plasma membrane; integral to membrane; external side of plasma membrane

Molecular Function: protein binding; coreceptor activity; receptor activity; receptor binding

Biological Process: positive regulation of lymphotoxin A biosynthetic process; negative regulation of T cell anergy; T cell activation; viral reproduction; nerve growth factor receptor signaling pathway; positive regulation of transcription, DNA-dependent; positive regulation of interleukin-2 biosynthetic process; myeloid dendritic cell differentiation; positive regulation of activated T cell proliferation; positive regulation of interleukin-4 biosynthetic process; positive regulation of T-helper 2 cell differentiation; cell-cell signaling; T cell proliferation during immune response; positive regulation of cell proliferation; response to yeast; defense response to virus; aging; response to drug; epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; B cell activation; T cell costimulation; toll-like receptor signaling pathway; innate immune response; immune response

Research Articles on CD86

Similar Products

Product Notes

The CD86 cd86 (Catalog #AAA3215839) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD86 antibody - C-terminal region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's CD86 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD86 cd86 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DVTSNMTIFC ILETDKTRLL SSPFSIGTNT MEREESEQTK KREKIHIPER. It is sometimes possible for the material contained within the vial of "CD86, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.