Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CD82 AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)

Rabbit anti-Human, Yeast CD82 Polyclonal Antibody | anti-CD82 antibody

CD82 antibody - C-terminal region

Gene Names
CD82; R2; 4F9; C33; IA4; ST6; GR15; KAI1; SAR2; TSPAN27
Reactivity
Human, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD82; Polyclonal Antibody; CD82 antibody - C-terminal region; anti-CD82 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DYVQAQVKCCGWVSFYNWTDNAELMNRPEVTYPCSCEVKGEEDNSLSVRK
Sequence Length
267
Applicable Applications for anti-CD82 antibody
Western Blot (WB)
Homology
Human: 100%; Yeast: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CD82 AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)

Western Blot (WB) (WB Suggested Anti-CD82 AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
Related Product Information for anti-CD82 antibody
This is a rabbit polyclonal antibody against CD82. It was validated on Western Blot

Target Description: This metastasis suppressor gene product is a membrane glycoprotein that is a member of the transmembrane 4 superfamily. Expression of this gene has been shown to be downregulated in tumor progression of human cancers and can be activated by p53 through a consensus binding sequence in the promoter. Its expression and that of p53 are strongly correlated, and the loss of expression of these two proteins is associated with poor survival for prostate cancer patients. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Product Categories/Family for anti-CD82 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
CD82 antigen isoform 1
NCBI Official Synonym Full Names
CD82 molecule
NCBI Official Symbol
CD82
NCBI Official Synonym Symbols
R2; 4F9; C33; IA4; ST6; GR15; KAI1; SAR2; TSPAN27
NCBI Protein Information
CD82 antigen
UniProt Protein Name
CD82 antigen
Protein Family
UniProt Gene Name
CD82
UniProt Synonym Gene Names
KAI1; SAR2; ST6; TSPAN27; Tspan-27
UniProt Entry Name
CD82_HUMAN

NCBI Description

This metastasis suppressor gene product is a membrane glycoprotein that is a member of the transmembrane 4 superfamily. Expression of this gene has been shown to be downregulated in tumor progression of human cancers and can be activated by p53 through a consensus binding sequence in the promoter. Its expression and that of p53 are strongly correlated, and the loss of expression of these two proteins is associated with poor survival for prostate cancer patients. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CD82: a widespread transmembrane protein of the tetraspanin family. A metastasis-suppressor whose decreased expression may be involved in malignant progression. Suppresses tumor metastasis of many cancers including cancers of the prostate, bladder, colon, cervix, liver, and lung (NSCLC). It is a target of estrogen receptor-mediated gene repression and is downregulated in primary human breast cancer. May be a prognostic marker for lung cancer and tumor metastatic potential. Interacts with cell surface proteins including integrins, cadherins, CD4, CD8, IGSF8. Modulates EGFR signaling. May suppress invasion by inhibiting integrin-dependent crosstalk with c-Met receptor and Src kinases. Its regulation of c-Met signaling apparently affects cancer cell migration.

Protein type: Cell surface; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11p11.2

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: protein binding

Disease: Prostate Cancer

Research Articles on CD82

Similar Products

Product Notes

The CD82 cd82 (Catalog #AAA3215984) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD82 antibody - C-terminal region reacts with Human, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's CD82 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD82 cd82 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DYVQAQVKCC GWVSFYNWTD NAELMNRPEV TYPCSCEVKG EEDNSLSVRK. It is sometimes possible for the material contained within the vial of "CD82, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.