Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Sample Type: Human MDA-MB231Lanes :Lane 1: 10ug MDA-MB-231 lysateLane 2: MDA-MB-231 + CD44 siRNAPrimary Antibody Dilution :1:1000Secondary Antibody :Goat anti rabbit-HRPSecondary Antibody Dilution :1:10,000Gene Name :CD44Submitted by :Chul Geun Kim and Dae Hyun Ha, Hanyang University.CD44 is strongly supported by BioGPS gene expression data to be expressed in MDA-MB231)

Rabbit CD44 Polyclonal Antibody | anti-CD44 antibody

CD44 antibody - C-terminal region

Gene Names
CD44; IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; CDW44; CSPG8; HCELL; HUTCH-I; ECMR-III
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD44; Polyclonal Antibody; CD44 antibody - C-terminal region; anti-CD44 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSETPDQFMTADETRNLQN
Sequence Length
361
Applicable Applications for anti-CD44 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CD44
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type: Human MDA-MB231Lanes :Lane 1: 10ug MDA-MB-231 lysateLane 2: MDA-MB-231 + CD44 siRNAPrimary Antibody Dilution :1:1000Secondary Antibody :Goat anti rabbit-HRPSecondary Antibody Dilution :1:10,000Gene Name :CD44Submitted by :Chul Geun Kim and Dae Hyun Ha, Hanyang University.CD44 is strongly supported by BioGPS gene expression data to be expressed in MDA-MB231)

Western Blot (WB) (Sample Type: Human MDA-MB231Lanes :Lane 1: 10ug MDA-MB-231 lysateLane 2: MDA-MB-231 + CD44 siRNAPrimary Antibody Dilution :1:1000Secondary Antibody :Goat anti rabbit-HRPSecondary Antibody Dilution :1:10,000Gene Name :CD44Submitted by :Chul Geun Kim and Dae Hyun Ha, Hanyang University.CD44 is strongly supported by BioGPS gene expression data to be expressed in MDA-MB231)

Western Blot (WB)

(WB Suggested Anti-CD44 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Western Blot (WB) (WB Suggested Anti-CD44 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
Related Product Information for anti-CD44 antibody
This is a rabbit polyclonal antibody against CD44. It was validated on Western Blot

Target Description: The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined.
Product Categories/Family for anti-CD44 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
960
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
CD44 antigen isoform 4
NCBI Official Synonym Full Names
CD44 molecule (Indian blood group)
NCBI Official Symbol
CD44
NCBI Official Synonym Symbols
IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; CDW44; CSPG8; HCELL; HUTCH-I; ECMR-III
NCBI Protein Information
CD44 antigen
UniProt Protein Name
CD44 antigen
Protein Family
UniProt Gene Name
CD44
UniProt Synonym Gene Names
LHR; MDU2; MDU3; MIC4; ECMR-III; PGP-1; PGP-I
UniProt Entry Name
CD44_HUMAN

NCBI Description

The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined. Alternative splicing is the basis for the structural and functional diversity of this protein, and may be related to tumor metastasis. [provided by RefSeq, Jul 2008]

Uniprot Description

CD44: Receptor for hyaluronic acid (HA). Mediates cell-cell and cell-matrix interactions through its affinity for HA, and possibly also through its affinity for other ligands such as osteopontin, collagens, and matrix metalloproteinases (MMPs). Adhesion with HA plays an important role in cell migration, tumor growth and progression. Also involved in lymphocyte activation, recirculation and homing, and in hematopoiesis. Altered expression or dysfunction causes numerous pathogenic phenotypes. Great protein heterogeneity due to numerous alternative splicing and post-translational modification events. Interacts with PKN2. Interacts with HA, as well as other glycosaminoglycans, collagen, laminin, and fibronectin via its N-terminal segment. Interacts with ANK, the ERM proteins (VIL2, RDX and MSN), and NF2 via its C-terminal segment. Isoform 10 (epithelial isoform) is expressed by cells of epithelium and highly expressed by carcinomas. Expression is repressed in neuroblastoma cells. 19 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Membrane protein, integral; Cell adhesion; Receptor, misc.

Chromosomal Location of Human Ortholog: 11p13

Cellular Component: Golgi apparatus; focal adhesion; cell surface; basolateral plasma membrane; integral to plasma membrane; cytoplasm; plasma membrane; external side of plasma membrane

Molecular Function: collagen binding; hematopoietin/interferon-class (D200-domain) cytokine receptor activity; protein binding; hyaluronic acid binding; hyalurononglucosaminidase activity

Biological Process: extracellular matrix organization and biogenesis; positive regulation of heterotypic cell-cell adhesion; Wnt receptor signaling pathway; glycosaminoglycan metabolic process; cytokine and chemokine mediated signaling pathway; cell-matrix adhesion; pathogenesis; negative regulation of caspase activity; positive regulation of peptidyl-serine phosphorylation; hyaluronan catabolic process; extracellular matrix disassembly; negative regulation of DNA damage response, signal transduction by p53 class mediator; positive regulation of peptidyl-tyrosine phosphorylation; cell-cell adhesion; ureteric bud branching; cartilage development; carbohydrate metabolic process; blood coagulation; leukocyte migration; hyaluronan metabolic process; healing during inflammatory response; negative regulation of apoptosis

Disease: Blood Group, Indian System

Research Articles on CD44

Similar Products

Product Notes

The CD44 cd44 (Catalog #AAA3215054) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD44 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CD44 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD44 cd44 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGNGAVEDRK PSGLNGEASK SQEMVHLVNK ESSETPDQFM TADETRNLQN. It is sometimes possible for the material contained within the vial of "CD44, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.