Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry with Thymus tissue at an antibody concentration of 5ug/ml using anti-CD40LG antibody )

Rabbit CD40LG Polyclonal Antibody | anti-CD40LG antibody

CD40LG antibody - middle region

Gene Names
CD40LG; IGM; IMD3; TRAP; gp39; CD154; CD40L; HIGM1; T-BAM; TNFSF5; hCD40L
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CD40LG; Polyclonal Antibody; CD40LG antibody - middle region; anti-CD40LG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN
Sequence Length
261
Applicable Applications for anti-CD40LG antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 83%; Pig: 100%; Rabbit: 92%; Rat: 85%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CD40LG
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry with Thymus tissue at an antibody concentration of 5ug/ml using anti-CD40LG antibody )

Immunohistochemistry (IHC) (Immunohistochemistry with Thymus tissue at an antibody concentration of 5ug/ml using anti-CD40LG antibody )

Western Blot (WB)

(Host: RabbitTarget Name: CD40LGSample Type: Human Fetal MuscleLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

Western Blot (WB) (Host: RabbitTarget Name: CD40LGSample Type: Human Fetal MuscleLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

Western Blot (WB)

(WB Suggested Anti-CD40LG Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-CD40LG Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Muscle)
Related Product Information for anti-CD40LG antibody
This is a rabbit polyclonal antibody against CD40LG. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CD40LG is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome.The protein encoded by this gene is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1375 BC071754.1 1-1375 1376-1599 X67878.1 1349-1572 1600-1834 BC071754.1 1596-1830

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
959
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
CD40 ligand
NCBI Official Synonym Full Names
CD40 ligand
NCBI Official Symbol
CD40LG
NCBI Official Synonym Symbols
IGM; IMD3; TRAP; gp39; CD154; CD40L; HIGM1; T-BAM; TNFSF5; hCD40L
NCBI Protein Information
CD40 ligand
UniProt Protein Name
CD40 ligand
Protein Family
UniProt Gene Name
CD40LG
UniProt Synonym Gene Names
CD40L; TNFSF5; TRAP; CD40-L; TRAP
UniProt Entry Name
CD40L_HUMAN

NCBI Description

The protein encoded by this gene is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome. [provided by RefSeq, Jul 2008]

Uniprot Description

CD40LG: Mediates B-cell proliferation in the absence of co- stimulus as well as IgE production in the presence of IL-4. Involved in immunoglobulin class switching. Defects in CD40LG are the cause of X-linked immunodeficiency with hyper-IgM type 1 (HIGM1); also known as X-linked hyper IgM syndrome (XHIM). HIGM1 is an immunoglobulin isotype switch defect characterized by elevated concentrations of serum IgM and decreased amounts of all other isotypes. Affected males present at an early age (usually within the first year of life) recurrent bacterial and opportunistic infections, including Pneumocystis carinii pneumonia and intractable diarrhea due to cryptosporidium infection. Despite substitution treatment with intravenous immunoglobulin, the overall prognosis is rather poor, with a death rate of about 10% before adolescence. Belongs to the tumor necrosis factor family.

Protein type: Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: Xq26

Cellular Component: extracellular space; integral to plasma membrane; integral to membrane; plasma membrane; external side of plasma membrane

Molecular Function: CD40 receptor binding; cytokine activity; tumor necrosis factor receptor binding

Biological Process: B cell proliferation; platelet activation; leukocyte adhesion; regulation of immune response; positive regulation of interleukin-12 production; immunoglobulin secretion; B cell differentiation; isotype switching; inflammatory response; regulation of immunoglobulin secretion; negative regulation of apoptosis

Disease: Immunodeficiency With Hyper-igm, Type 1

Research Articles on CD40LG

Similar Products

Product Notes

The CD40LG cd40lg (Catalog #AAA3201741) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD40LG antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CD40LG can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CD40LG cd40lg for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ENSFEMQKGD QNPQIAAHVI SEASSKTTSV LQWAEKGYYT MSNNLVTLEN. It is sometimes possible for the material contained within the vial of "CD40LG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.