Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CD37 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)

Rabbit CD37 Polyclonal Antibody | anti-CD37 antibody

CD37 antibody - middle region

Gene Names
CD37; GP52-40; TSPAN26
Reactivity
Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD37; Polyclonal Antibody; CD37 antibody - middle region; anti-CD37 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QDWFQVLILRGNGSEAHRVPCSCYNLSATNDSTILDKVILPQLSRLGHLA
Sequence Length
213
Applicable Applications for anti-CD37 antibody
Western Blot (WB)
Homology
Human: 100%; Rabbit: 93%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CD37 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)

Western Blot (WB) (WB Suggested Anti-CD37 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole Cell)
Related Product Information for anti-CD37 antibody
This is a rabbit polyclonal antibody against CD37. It was validated on Western Blot

Target Description: The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It may play a role in T-cell-B-cell interactions. Alternate splicing results in multiple transcript variants encoding different isoforms.
Product Categories/Family for anti-CD37 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
951
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
leukocyte antigen CD37 isoform B
NCBI Official Synonym Full Names
CD37 molecule
NCBI Official Symbol
CD37
NCBI Official Synonym Symbols
GP52-40; TSPAN26
NCBI Protein Information
leukocyte antigen CD37
UniProt Protein Name
Leukocyte antigen CD37
Protein Family
UniProt Gene Name
CD37
UniProt Synonym Gene Names
TSPAN26; Tspan-26
UniProt Entry Name
CD37_HUMAN

NCBI Description

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It may play a role in T-cell-B-cell interactions. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

CD37: is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It may play a role in T-cell-B-cell interactions. Alternate splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: immunological synapse; integral to plasma membrane; membrane

Molecular Function: protein binding

Biological Process: cell surface receptor linked signal transduction

Research Articles on CD37

Similar Products

Product Notes

The CD37 cd37 (Catalog #AAA3216094) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD37 antibody - middle region reacts with Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CD37 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD37 cd37 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QDWFQVLILR GNGSEAHRVP CSCYNLSATN DSTILDKVIL PQLSRLGHLA. It is sometimes possible for the material contained within the vial of "CD37, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.