Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CD300ASample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CD300A Polyclonal Antibody | anti-CD300A antibody

CD300A Antibody - middle region

Gene Names
CD300A; IRC1; IRC2; CLM-8; IRp60; IGSF12; CMRF35H; CMRF-35H; CMRF35-H; CMRF35H9; CMRF35-H9; IRC1/IRC2; CMRF-35-H9
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CD300A; Polyclonal Antibody; CD300A Antibody - middle region; anti-CD300A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLLALLLLLLVGASLLAWRMFQKWIKAGDHSELSQNPKQAATQSELHYAN
Sequence Length
299
Applicable Applications for anti-CD300A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CD300A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CD300ASample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CD300ASample Tissue: Human 786-0 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CD300A antibody
This gene encodes a member of the CD300 glycoprotein family of cell surface proteins found on leukocytes involved in immune response signaling pathways. This gene is located on chromosome 17 in a cluster with all but one of the other family members. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-CD300A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33 kDa
NCBI Official Full Name
CMRF35-like molecule 8 isoform 2
NCBI Official Synonym Full Names
CD300a molecule
NCBI Official Symbol
CD300A
NCBI Official Synonym Symbols
IRC1; IRC2; CLM-8; IRp60; IGSF12; CMRF35H; CMRF-35H; CMRF35-H; CMRF35H9; CMRF35-H9; IRC1/IRC2; CMRF-35-H9
NCBI Protein Information
CMRF35-like molecule 8
UniProt Protein Name
CMRF35-like molecule 8
Protein Family
UniProt Gene Name
CD300A
UniProt Synonym Gene Names
CMRF35H; IGSF12; CLM-8; CMRF35-H9; IgSF12; IRp60
UniProt Entry Name
CLM8_HUMAN

NCBI Description

This gene encodes a member of the CD300 glycoprotein family of cell surface proteins found on leukocytes involved in immune response signaling pathways. This gene is located on chromosome 17 in a cluster with all but one of the other family members. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]

Uniprot Description

MAIR-I: Inhibitory receptor which may contribute to the down- regulation of cytolytic activity in natural killer (NK) cells, and to the down-regulation of mast cell degranulation. Belongs to the CD300 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Immunoglobulin superfamily

Chromosomal Location of Human Ortholog: 17q25.1

Cellular Component: membrane; plasma membrane; integral to membrane

Molecular Function: protein binding; phosphatidylethanolamine binding; phosphatidylserine binding

Biological Process: positive regulation of phosphoprotein phosphatase activity; negative regulation of MAP kinase activity; negative regulation of NK T cell activation; immune system process; negative regulation of mast cell degranulation; negative regulation of mast cell activation during immune response; negative regulation of B cell proliferation; signal transduction; negative regulation of phagocytosis, engulfment; negative regulation of fibroblast proliferation; negative regulation of B cell receptor signaling pathway; regulation of T cell receptor signaling pathway; cell adhesion

Research Articles on CD300A

Similar Products

Product Notes

The CD300A cd300a (Catalog #AAA3220881) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD300A Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD300A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD300A cd300a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLLALLLLLL VGASLLAWRM FQKWIKAGDH SELSQNPKQA ATQSELHYAN. It is sometimes possible for the material contained within the vial of "CD300A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.