Western Blot (WB)
(Host: RabbitTarget Name: CD248Sample Tissue: Human Leiomyosarcoma Tumor lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human CD248 Polyclonal Antibody | anti-CD248 antibody
CD248 Antibody - middle region
Gene Names
CD248; TEM1; CD164L1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CD248; Polyclonal Antibody; CD248 Antibody - middle region; anti-CD248 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DGISCSPAGAMGAQASQDLGDELLDDGEDEEDEDEAWKAFNGGWTEMPGI
Sequence Length
433
Applicable Applications for anti-CD248 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CD248
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: CD248Sample Tissue: Human Leiomyosarcoma Tumor lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CD248Sample Tissue: Human Leiomyosarcoma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CD248 antibody
May play a role in tumor angiogenesis.
Product Categories/Family for anti-CD248 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47 kDa
NCBI Official Full Name
endosialin
NCBI Official Synonym Full Names
CD248 molecule
NCBI Official Symbol
CD248
NCBI Official Synonym Symbols
TEM1; CD164L1
NCBI Protein Information
endosialin
UniProt Protein Name
Endosialin
Protein Family
UniProt Gene Name
CD248
UniProt Synonym Gene Names
CD164L1; TEM1
UniProt Entry Name
CD248_HUMAN
Uniprot Description
CD248: May play a role in tumor angiogenesis. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 11q13
Cellular Component: proteinaceous extracellular matrix; cytoplasm; integral to membrane
Molecular Function: extracellular matrix binding; calcium ion binding; carbohydrate binding
Biological Process: cell migration; positive regulation of cell proliferation; anatomical structure regression; lymph node development
Research Articles on CD248
Similar Products
Product Notes
The CD248 cd248 (Catalog #AAA3221750) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD248 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD248 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD248 cd248 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DGISCSPAGA MGAQASQDLG DELLDDGEDE EDEDEAWKAF NGGWTEMPGI. It is sometimes possible for the material contained within the vial of "CD248, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
