Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CD22 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

Rabbit anti-Horse, Human CD22 Polyclonal Antibody | anti-CD22 antibody

CD22 antibody - C-terminal region

Gene Names
CD22; SIGLEC2; SIGLEC-2
Reactivity
Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD22; Polyclonal Antibody; CD22 antibody - C-terminal region; anti-CD22 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENVDYVIL
Sequence Length
847
Applicable Applications for anti-CD22 antibody
Western Blot (WB)
Homology
Horse: 79%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CD22
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CD22 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-CD22 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human brain)
Related Product Information for anti-CD22 antibody
This is a rabbit polyclonal antibody against CD22. It was validated on Western Blot

Target Description: CD22 mediates B-cell B-cell interactions. CD22 may be involved in the localization of B-cells in lymphoid tissues. CD22 binds sialylated glycoproteins; one of which is CD45. CD22 preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response CD22 seems to be involved in regulation of B-cell antigen receptor signaling. CD22 plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules.
Product Categories/Family for anti-CD22 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
933
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
95kDa
NCBI Official Full Name
B-cell receptor CD22 isoform 1
NCBI Official Synonym Full Names
CD22 molecule
NCBI Official Symbol
CD22
NCBI Official Synonym Symbols
SIGLEC2; SIGLEC-2
NCBI Protein Information
B-cell receptor CD22
UniProt Protein Name
B-cell receptor CD22
Protein Family
UniProt Gene Name
CD22
UniProt Synonym Gene Names
SIGLEC2; BL-CAM; Siglec-2
UniProt Entry Name
CD22_HUMAN

Uniprot Description

CD22: Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules. Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19q13.1

Cellular Component: integral to plasma membrane; external side of plasma membrane

Molecular Function: protein binding; carbohydrate binding

Biological Process: cell adhesion

Research Articles on CD22

Similar Products

Product Notes

The CD22 cd22 (Catalog #AAA3214542) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD22 antibody - C-terminal region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD22 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD22 cd22 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YSALHKRQVG DYENVIPDFP EDEGIHYSEL IQFGVGERPQ AQENVDYVIL. It is sometimes possible for the material contained within the vial of "CD22, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.