Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CD200R1LSample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human, Rat CD200R1L Polyclonal Antibody | anti-CD200R1L antibody

CD200R1L Antibody - N-terminal region

Gene Names
CD200R1L; CD200R2; CD200RLa
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD200R1L; Polyclonal Antibody; CD200R1L Antibody - N-terminal region; anti-CD200R1L antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ETKETNCTVERITWVSRPDQNSDLQIRPVDTTHDGYYRGIVVTPDGNFHR
Sequence Length
271
Applicable Applications for anti-CD200R1L antibody
Western Blot (WB)
Homology
Human: 100%; Rat: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CD200R1L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CD200R1LSample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CD200R1LSample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CD200R1L antibody
This is a rabbit polyclonal antibody against CD200R1L. It was validated on Western Blot

Target Description: CD200R1L may be a receptor for the CD200/OX2 cell surface glycoprotein.
Product Categories/Family for anti-CD200R1L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
cell surface glycoprotein CD200 receptor 2 isoform 1
NCBI Official Synonym Full Names
CD200 receptor 1 like
NCBI Official Symbol
CD200R1L
NCBI Official Synonym Symbols
CD200R2; CD200RLa
NCBI Protein Information
cell surface glycoprotein CD200 receptor 2
UniProt Protein Name
Cell surface glycoprotein CD200 receptor 2
UniProt Gene Name
CD200R1L
UniProt Synonym Gene Names
CD200R2; CD200 receptor-like 2; HuCD200R2; CD200RLa
UniProt Entry Name
MO2R2_HUMAN

Uniprot Description

CD200R1L: May be a receptor for the CD200/OX2 cell surface glycoprotein. Belongs to the CD200R family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 3q13.2

Cellular Component: integral to membrane

Similar Products

Product Notes

The CD200R1L cd200r1l (Catalog #AAA3218255) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD200R1L Antibody - N-terminal region reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CD200R1L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD200R1L cd200r1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ETKETNCTVE RITWVSRPDQ NSDLQIRPVD TTHDGYYRGI VVTPDGNFHR. It is sometimes possible for the material contained within the vial of "CD200R1L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.