Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human CD164 Polyclonal Antibody | anti-CD164 antibody

CD164 Polyclonal Antibody

Gene Names
CD164; DFNA66; MGC-24; MUC-24; MGC-24v; endolyn
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CD164; Polyclonal Antibody; CD164 Polyclonal Antibody; DFNA66; endolyn; MGC-24; MUC-24; anti-CD164 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
DKNTTQHPNVTTLAPISNVTSAPVTSLPLVTTPAPETCEGRNSCVSCFNVSVVNTTCFWIECKDESYCSHNSTVSDCQVGNTTDFCSVSTATPVPTANSTAKPTVQPSPSTTSKTVTTSGTTNNTVTPTSQPVRKSTFD
Sequence Length
184
Applicable Applications for anti-CD164 antibody
Western Blot (WB)
Application Notes
WB: 1:1000 - 1:2000
Immunogen
Recombinant protein of human CD164
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Endosome membrane, Lysosome membrane, Secreted, Single-pass type I membrane protein, Single-pass type I membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Product Categories/Family for anti-CD164 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16kDa/19kDa/20kDa
NCBI Official Full Name
sialomucin core protein 24 isoform 2
NCBI Official Synonym Full Names
CD164 molecule
NCBI Official Symbol
CD164
NCBI Official Synonym Symbols
DFNA66; MGC-24; MUC-24; MGC-24v; endolyn
NCBI Protein Information
sialomucin core protein 24
UniProt Protein Name
Sialomucin core protein 24
UniProt Gene Name
CD164
UniProt Synonym Gene Names
MUC-24; MGC-24; MGC-24v

NCBI Description

This gene encodes a transmembrane sialomucin and cell adhesion molecule that regulates the proliferation, adhesion and migration of hematopoietic progenitor cells. The encoded protein also interacts with the C-X-C chemokine receptor type 4 and may regulate muscle development. Elevated expression of this gene has been observed in human patients with Sezary syndrome, a type of blood cancer, and a mutation in this gene may be associated with impaired hearing. [provided by RefSeq, Oct 2016]

Uniprot Description

Sialomucin that may play a key role in hematopoiesis by facilitating the adhesion of CD34+ cells to the stroma and by negatively regulating CD34+CD38(lo/-) cell proliferation. Modulates the migration of umbilical cord blood CD133+ cells and this is mediated through the CXCL12/CXCR4 axis. May play an important role in prostate cancer metastasis and the infiltration of bone marrow by cancer cells. Promotes myogenesis by enhancing CXCR4-dependent cell motility. Positively regulates myoblast migration and promotes myoblast fusion into myotubes ().

Research Articles on CD164

Similar Products

Product Notes

The CD164 cd164 (Catalog #AAA9133301) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD164 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD164 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:1000 - 1:2000. Researchers should empirically determine the suitability of the CD164 cd164 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DKNTTQHPNV TTLAPISNVT SAPVTSLPLV TTPAPETCEG RNSCVSCFNV SVVNTTCFWI ECKDESYCSH NSTVSDCQVG NTTDFCSVST ATPVPTANST AKPTVQPSPS TTSKTVTTSG TTNNTVTPTS QPVRKSTFD. It is sometimes possible for the material contained within the vial of "CD164, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.