Rabbit anti-Human CD160 Polyclonal Antibody | anti-CD160 antibody

CD160 (CD160 Antigen, Natural Killer Cell Receptor BY55, BY55) (Biotin)

Cat. Num. AAA6372830

• Gene Names: CD160; NK1; BY55; NK28
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CD160; Polyclonal Antibody; CD160 (CD160 Antigen; Natural Killer Cell Receptor BY55; BY55) (Biotin); anti-CD160 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CD160.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 1580

• Applicable Applications for anti-CD160 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length human CD160, aa1-181 (AAH14465.1).
• Immunogen Sequence: MLLEPGRGCCALAILLAIVDIQSGGCINITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLSSGFLQEKVWVMLVTSLVALQAL
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CD160 expression in transfected 293T cell line by CD160 polyclonal antibody. Lane 1: CD160 transfected lysate (19.8kD). Lane 2: Non-transfected lysate. )

Related Product Information for anti-CD160 antibody

CD160 is a 27kD member of Ig superfamily of molecules. It is expressed on select hematopoietic cell types, including CD56dimCD16+ cytotoxic NK cells, CD8+CD28 effector T cells, YdT cells, and restricted CD4+ T cells. It is a receptor for HLAC molecules, and its engagement induces CD160+ NK cells to both secrete IFN-Y plus TNF-A, and initiate a cytotoxic program. Human CD160 was originally identified as a 155aa pro-protein aa27-181. It contains a 132aa mature region aa27-159 and a C-terminal pro-segment that is cleaved to create a GPI linkage. The mature region possesses one V-type Ig-like domain aa27-122. CD160 is found as a soluble, disulfide-linked 80kD multimer (likely trimer) that is generated by proteolysis of the GPI-linked form. This 80kD form, plus others, are highly resistant to reduction. There is also a 100-110kD multimeric transmembrane (TM) form that is associated with activated NK cells. It contains a 55aa substitution for aa180-181, and shows a 20aa TM segment between aa163-182. The TM form appears to have a splice variant that lacks aa25-133. Over aa27-159, human CD160 shares only 62% aa sequence identity with mouse CD160.

Product Categories/Family for anti-CD160 antibody

Antibodies; CD Markers

NCBI and Uniprot Product Information

• NCBI GI #: 1653962283
• NCBI GeneID: 11126
• NCBI Accession #: NM_007053.4
• NCBI GenBank Nucleotide #: NM_007053
• UniProt Accession #: O95971
• NCBI Official Full Name: Homo sapiens CD160 molecule (CD160), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: CD160 molecule
• NCBI Official Symbol: CD160
• NCBI Official Synonym Symbols: NK1; BY55; NK28
• NCBI Protein Information: CD160 antigen
• UniProt Protein Name: CD160 antigen
• Protein Family: CD160 antigen
• UniProt Gene Name: CD160
• UniProt Synonym Gene Names: BY55
• UniProt Entry Name: BY55_HUMAN

NCBI Description

CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. The cDNA sequence of CD160 predicts a cysteine-rich, glycosylphosphatidylinositol-anchored protein of 181 amino acids with a single Ig-like domain weakly homologous to KIR2DL4 molecule. CD160 is expressed at the cell surface as a tightly disulfide-linked multimer. RNA blot analysis revealed CD160 mRNAs of 1.5 and 1.6 kb whose expression was highly restricted to circulating NK and T cells, spleen and small intestine. Within NK cells CD160 is expressed by CD56dimCD16+ cells whereas among circulating T cells its expression is mainly restricted to TCRgd bearing cells and to TCRab+CD8brightCD95+CD56+CD28-CD27-cells. In tissues, CD160 is expressed on all intestinal intraepithelial lymphocytes. CD160 shows a broad specificity for binding to both classical and nonclassical MHC class I molecules. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Receptor showing broad specificity for both classical and non-classical MHC class I molecules. Ref.3

Subunit structure: Homomultimer; disulfide-linked.

Subcellular location: Cell membrane; Lipid-anchor › GPI-anchor.

Tissue specificity: Expressed in spleen, peripheral blood, and small intestine. Expression is restricted to functional NK and T cytotoxic lymphocytes.

Sequence similarities: Contains 1 Ig-like V-type (immunoglobulin-like) domain.