Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CD160 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)

Rabbit anti-Human CD160 Polyclonal Antibody | anti-CD160 antibody

CD160 antibody - middle region

Gene Names
CD160; NK1; BY55; NK28
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD160; Polyclonal Antibody; CD160 antibody - middle region; anti-CD160 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEG
Sequence Length
181
Applicable Applications for anti-CD160 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CD160
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CD160 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-CD160 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)
Related Product Information for anti-CD160 antibody
This is a rabbit polyclonal antibody against CD160. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. The cDNA sequence of CD160 predic
Product Categories/Family for anti-CD160 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
CD160 antigen
NCBI Official Synonym Full Names
CD160 molecule
NCBI Official Symbol
CD160
NCBI Official Synonym Symbols
NK1; BY55; NK28
NCBI Protein Information
CD160 antigen
UniProt Protein Name
CD160 antigen
Protein Family
UniProt Gene Name
CD160
UniProt Synonym Gene Names
BY55
UniProt Entry Name
BY55_HUMAN

NCBI Description

CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. The cDNA sequence of CD160 predicts a cysteine-rich, glycosylphosphatidylinositol-anchored protein of 181 amino acids with a single Ig-like domain weakly homologous to KIR2DL4 molecule. CD160 is expressed at the cell surface as a tightly disulfide-linked multimer. RNA blot analysis revealed CD160 mRNAs of 1.5 and 1.6 kb whose expression was highly restricted to circulating NK and T cells, spleen and small intestine. Within NK cells CD160 is expressed by CD56dimCD16+ cells whereas among circulating T cells its expression is mainly restricted to TCRgd bearing cells and to TCRab+CD8brightCD95+CD56+CD28-CD27-cells. In tissues, CD160 is expressed on all intestinal intraepithelial lymphocytes. CD160 shows a broad specificity for binding to both classical and nonclassical MHC class I molecules. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Receptor showing broad specificity for both classical and non-classical MHC class I molecules. Ref.3

Subunit structure: Homomultimer; disulfide-linked.

Subcellular location: Cell membrane; Lipid-anchor › GPI-anchor.

Tissue specificity: Expressed in spleen, peripheral blood, and small intestine. Expression is restricted to functional NK and T cytotoxic lymphocytes.

Sequence similarities: Contains 1 Ig-like V-type (immunoglobulin-like) domain.

Research Articles on CD160

Similar Products

Product Notes

The CD160 cd160 (Catalog #AAA3206318) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD160 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD160 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD160 cd160 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGTYQCCARS QKSGIRLQGH FFSILFTETG NYTVTGLKQR QHLEFSHNEG. It is sometimes possible for the material contained within the vial of "CD160, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.