Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type :Rat Hippocampal Neurons - 14DIVPrimary Antibody Dilution :1:200Secondary Antibody :Anti-rabbit-Cy3Secondary Antibody Dilution :1:500Color/Signal Descriptions :White: CCT4Gene Name :CCT4Submitted by :Dan Fowler - University of Oregon, Institute of Neuroscience)

Rabbit CCT4 Polyclonal Antibody | anti-CCT4 antibody

CCT4 antibody - C-terminal region

Gene Names
CCT4; SRB; Cctd; CCT-DELTA
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
CCT4; Polyclonal Antibody; CCT4 antibody - C-terminal region; anti-CCT4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AFADAMEVIPSTLAENAGLNPISTVTELRNRHAQGEKTAGINVRKGGISN
Sequence Length
539
Applicable Applications for anti-CCT4 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Goat: 79%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Yeast: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CCT4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type :Rat Hippocampal Neurons - 14DIVPrimary Antibody Dilution :1:200Secondary Antibody :Anti-rabbit-Cy3Secondary Antibody Dilution :1:500Color/Signal Descriptions :White: CCT4Gene Name :CCT4Submitted by :Dan Fowler - University of Oregon, Institute of Neuroscience)

Immunohistochemistry (IHC) (Sample Type :Rat Hippocampal Neurons - 14DIVPrimary Antibody Dilution :1:200Secondary Antibody :Anti-rabbit-Cy3Secondary Antibody Dilution :1:500Color/Signal Descriptions :White: CCT4Gene Name :CCT4Submitted by :Dan Fowler - University of Oregon, Institute of Neuroscience)
Related Product Information for anti-CCT4 antibody
This is a rabbit polyclonal antibody against CCT4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CCT4 is a subunit of a cytosolic hetero-oligomeric chaperone that is known to be involved in the folding of actin and tubulin. This protein is a member of the chaperonin family, which includes Escherichia coli GroEL, the mitochondrial heat-shock protein Hsp60, the plastid Rubisco-subunit-binding protein and the archaebacterial protein TF55.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
T-complex protein 1 subunit delta isoform a
NCBI Official Synonym Full Names
chaperonin containing TCP1 subunit 4
NCBI Official Symbol
CCT4
NCBI Official Synonym Symbols
SRB; Cctd; CCT-DELTA
NCBI Protein Information
T-complex protein 1 subunit delta
Protein Family

NCBI Description

The chaperonin containing TCP1 (MIM 186980) complex (CCT), also called the TCP1 ring complex, consists of 2 back-to-back rings, each containing 8 unique but homologous subunits, such as CCT4. CCT assists the folding of newly translated polypeptide substrates through multiple rounds of ATP-driven release and rebinding of partially folded intermediate forms. Substrates of CCT include the cytoskeletal proteins actin (see MIM 102560) and tubulin (see MIM 191130), as well as alpha-transducin (MIM 139330) (Won et al., 1998 [PubMed 9819444]).[supplied by OMIM, Mar 2008]

Research Articles on CCT4

Similar Products

Product Notes

The CCT4 (Catalog #AAA3201957) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCT4 antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CCT4 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CCT4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AFADAMEVIP STLAENAGLN PISTVTELRN RHAQGEKTAG INVRKGGISN. It is sometimes possible for the material contained within the vial of "CCT4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.