Western Blot (WB)
(Western blot analysis of CCS expression in rat brain extract (lane 1), rat spleen extract (lane 2), mouse brain extract (lane 3), mouse spleen extract (lane 4) and 293T whole cell lysates (lane 5). CCS at 34KD was detected using rabbit anti- CCS Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Rabbit CCS Polyclonal Antibody | anti-CCS antibody
Anti-CCS Antibody
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen affinity purified.
Synonyms
CCS; Polyclonal Antibody; Anti-CCS Antibody; SOD 4; SOD4; O14618; Copper chaperone for superoxide dismutase; anti-CCS antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
274
Applicable Applications for anti-CCS antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot: 0.1-0.5ug/ml
Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml
Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human CCS (174-209aa DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR), different from the related mouse sequence by six amino acids, and from the related rat sequence by seven amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Western Blot (WB)
(Western blot analysis of CCS expression in rat brain extract (lane 1), rat spleen extract (lane 2), mouse brain extract (lane 3), mouse spleen extract (lane 4) and 293T whole cell lysates (lane 5). CCS at 34KD was detected using rabbit anti- CCS Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Western Blot (WB)
(Western blot analysis of CCS expression in rat brain extract (lane 1), rat spleen extract (lane 2), mouse brain extract (lane 3), mouse spleen extract (lane 4) and 293T whole cell lysates (lane 5). CCS at 34KD was detected using rabbit anti- CCS Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Immunohistochemistry (IHC)
(CCS was detected in paraffin-embedded sections of human tonsil tissues using rabbit anti- CCS Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )
Immunohistochemistry (IHC)
(CCS was detected in paraffin-embedded sections of human tonsil tissues using rabbit anti- CCS Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )
Related Product Information for anti-CCS antibody
Rabbit IgG polyclonal antibody for Copper chaperone for superoxide dismutase(CCS) detection.
Background: Copper chaperone for superoxide dismutase is a metalloprotein that is responsible for the delivery of Cu to superoxide dismutase (SOD1). In humans the protein is encoded by the CCS gene. And this gene is mapped to chromosome 11q13 by fluorescence in situ hybridization. The CCS protein is present in mammals and most eukaryotes including yeast. The structure of CCS is composed of three distinct domains that are necessary for its function. Although CCS is important for many organisms, there are CCS independent pathways for SOD1, and many species lack CCS all together, such as C. elegans.
Background: Copper chaperone for superoxide dismutase is a metalloprotein that is responsible for the delivery of Cu to superoxide dismutase (SOD1). In humans the protein is encoded by the CCS gene. And this gene is mapped to chromosome 11q13 by fluorescence in situ hybridization. The CCS protein is present in mammals and most eukaryotes including yeast. The structure of CCS is composed of three distinct domains that are necessary for its function. Although CCS is important for many organisms, there are CCS independent pathways for SOD1, and many species lack CCS all together, such as C. elegans.
References
1. Bartnikas, T. B., Waggoner, D. J., Casareno, R. L. B., Gaedigk, R., White, R. A., Gitlin, J. D. Chromosomal localization of CCS, the copper chaperone for Cu/Zn superoxide dismutase. Mammalian Genome 11: 409-411, 2000.
2. Casareno, R. L. B., Waggoner, D., Gitlin, J. D. The copper chaperone CCS directly interacts with copper/zinc superoxide dismutase.J. Biol. Chem. 273: 23625-23628, 1998.
3. Huppke, P., Brendel, C., Korenke, G. C., Marquardt, I., Donsante, A., Yi, L., Hicks, J. D., Steinbach, P. J., Wilson, C., Elpeleg, O., Moller, L. B., Christodoulou, J., Kaler, S. G., Gartner, J. Molecular and biochemical characterization of a unique mutation in CCS, the human copper chaperone to superoxide dismutase. Hum. Mutat. 33: 1207-1215, 2012.
2. Casareno, R. L. B., Waggoner, D., Gitlin, J. D. The copper chaperone CCS directly interacts with copper/zinc superoxide dismutase.J. Biol. Chem. 273: 23625-23628, 1998.
3. Huppke, P., Brendel, C., Korenke, G. C., Marquardt, I., Donsante, A., Yi, L., Hicks, J. D., Steinbach, P. J., Wilson, C., Elpeleg, O., Moller, L. B., Christodoulou, J., Kaler, S. G., Gartner, J. Molecular and biochemical characterization of a unique mutation in CCS, the human copper chaperone to superoxide dismutase. Hum. Mutat. 33: 1207-1215, 2012.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29,041 Da
NCBI Official Full Name
copper chaperone for superoxide dismutase
NCBI Official Synonym Full Names
copper chaperone for superoxide dismutase
NCBI Official Symbol
CCS
NCBI Protein Information
copper chaperone for superoxide dismutase
UniProt Protein Name
Copper chaperone for superoxide dismutase
Protein Family
UniProt Gene Name
CCS
NCBI Description
Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor. [provided by RefSeq, Jul 2008]
Uniprot Description
CCS: Delivers copper to copper zinc superoxide dismutase (SOD1).
Chromosomal Location of Human Ortholog: 11q13.2
Cellular Component: cell-cell adherens junction; cytoplasm; cytosol; nucleus
Molecular Function: copper ion binding; protein binding; protein disulfide oxidoreductase activity; superoxide dismutase activity; zinc ion binding
Biological Process: intracellular copper ion transport; removal of superoxide radicals; response to reactive oxygen species; superoxide metabolic process
Research Articles on CCS
Similar Products
Product Notes
The CCS ccs (Catalog #AAA178602) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-CCS Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CCS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot: 0.1-0.5ug/ml Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml. Researchers should empirically determine the suitability of the CCS ccs for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
