Rabbit anti-Human CCRL2 Polyclonal Antibody | anti-CCRL2 antibody

CCRL2 (Chemokine (C-C Motif) Receptor-like 2, CKRX, CRAM-A, CRAM-B, FLJ55815, HCR, MGC116710) (HRP)

Cat. Num. AAA6450622

• Gene Names: CCRL2; HCR; CKRX; CRAM; ACKR5; CCRL2; CRAM-A; CRAM-B
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified
• Synonyms: CCRL2; Polyclonal Antibody; CCRL2 (Chemokine (C-C Motif) Receptor-like 2; CKRX; CRAM-A; CRAM-B; FLJ55815; HCR; MGC116710) (HRP); Chemokine (C-C Motif) Receptor-like 2; MGC116710; anti-CCRL2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CCRL2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-CCRL2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: CCRL2 (NP_003956.2, 1aa-344aa) full-length human protein.
• Immunogen Sequence: MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFSARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLVLPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDKSVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.

Western Blot (WB)

(Western Blot analysis of CCRL2 expression in transfected 293T cell line by CCRL2 MaxPab polyclonal antibody.Lane 1: CCRL2 transfected lysate(39.5 KDa).Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-CCRL2 antibody

Antibodies; Growth Factors; Cytokines

NCBI and Uniprot Product Information

• NCBI GI #: 68215224
• NCBI GeneID: 9034
• NCBI Accession #: NP_003956.2
• NCBI GenBank Nucleotide #: NM_003965.4
• UniProt Accession #: O00421; O75307; Q4VBB0; Q6IPX0; Q7KYQ9; Q96KP5; Q9UPG0; B4DKQ8
• Molecular Weight: 40,952 Da
• NCBI Official Full Name: C-C chemokine receptor-like 2 isoform 1
• NCBI Official Synonym Full Names: chemokine (C-C motif) receptor-like 2
• NCBI Official Symbol: CCRL2
• NCBI Official Synonym Symbols: HCR; CKRX; CRAM; ACKR5; CCRL2; CRAM-A; CRAM-B
• NCBI Protein Information: C-C chemokine receptor-like 2; chemokine receptor X; chemokine receptor CCR11; atypical chemokine receptor 5; putative MCP-1 chemokine receptor
• UniProt Protein Name: C-C chemokine receptor-like 2
• Protein Family: C-C chemokine receptor
• UniProt Gene Name: CCRL2
• UniProt Synonym Gene Names: CCR11; CCR6; CKRX; CRAM; HCR
• UniProt Entry Name: CCRL2_HUMAN

NCBI Description

This gene encodes a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. This gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown. This gene is mapped to the region where the chemokine receptor gene cluster is located. [provided by RefSeq, Jul 2008]

Uniprot Description

CCRL2: Receptor for CCL19 and chemerin/RARRES2. Does not appear to be a signaling receptor, but may have a role in modulating chemokine-triggered immune responses by capturing and internalizing CCL19 or by presenting RARRES2 ligand to CMKLR1, a functional signaling receptors. Plays a critical role for the development of Th2 responses. Belongs to the G-protein coupled receptor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1

Chromosomal Location of Human Ortholog: 3p21

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: CCR chemokine receptor binding; chemokine receptor binding; chemokine receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; chemotaxis; inflammatory response