Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CCR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

Rabbit CCR2 Polyclonal Antibody | anti-CCR2 antibody

CCR2 antibody - middle region

Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Rat, Pig, Rabbit
Applications
Western Blot
Synonyms
CCR2; Polyclonal Antibody; CCR2 antibody - middle region; anti-CCR2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested Reactivity: Human
Predicted Reactivity: Human, Rat, Pig, Rabbit
Clonality
Polyclonal
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL
Applicable Applications for anti-CCR2 antibody
Western Blot (WB)
Protein Size (# AA)
374 amino acids
Blocking Peptide
For anti-CCR2 (MBS3213873) antibody is Catalog # MBS3238811
Predicted Homology
Based on Immunogen Sequence : Human: 100%; Pig: 93%; Rabbit: 93%; Rat: 93%
Replacement Item
This antibody may replace item sc-30032 from Santa Cruz Biotechnology.
Preparation and Storage
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CCR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

Western Blot (WB) (WB Suggested Anti-CCR2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)
Related Product Information for anti-CCR2 antibody
This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase.This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase. This gene is located in the chemokine receptor gene cluster region. Two alternatively spliced transcript variants are expressed by the gene.
Product Categories/Family for anti-CCR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
UniProt Protein Name
C-C chemokine receptor type 2
Protein Family
UniProt Gene Name
CCR2
UniProt Synonym Gene Names
CMKBR2; C-C CKR-2; CC-CKR-2; CCR-2; CCR2; MCP-1-R
UniProt Entry Name
CCR2_HUMAN

Uniprot Description

CCR2: a seven transmembrane protein closely related to CCR1. Receptor for the MCP-1, MCP-3 and MCP-4 chemokines. Expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. Transduces a signal by increasing the intracellular calcium ions level. Alternative co receptor with CD4 for HIV-1 infection. Two splice-variant isoforms have been described.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 3p21.31

Cellular Component: cell soma; integral to plasma membrane; perinuclear region of cytoplasm; cytoplasm; dendrite; plasma membrane; integral to membrane; perikaryon; cytosol

Molecular Function: protein homodimerization activity; CCR2 chemokine receptor binding; C-C chemokine receptor activity; chemokine receptor activity

Biological Process: viral reproduction; positive regulation of T-helper 1 type immune response; chemotaxis; elevation of cytosolic calcium ion concentration; response to wounding; dendritic cell chemotaxis; cellular homeostasis; inflammatory response; positive regulation of tumor necrosis factor biosynthetic process; cytokine and chemokine mediated signaling pathway; negative regulation of adenylate cyclase activity; JAK-STAT cascade; cellular calcium ion homeostasis; G-protein coupled receptor protein signaling pathway; negative regulation of angiogenesis; positive regulation of interferon-gamma production; negative regulation of T-helper 2 type immune response; positive regulation of interleukin-2 production; innate immune response; cellular defense response; positive regulation of alpha-beta T cell proliferation; immune response; blood vessel remodeling; negative regulation of eosinophil degranulation; positive regulation of T cell activation; positive regulation of inflammatory response

Similar Products

Product Notes

The CCR2 ccr2 (Catalog #AAA3213873) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCR2 antibody - middle region reacts with Tested Reactivity: Human Predicted Reactivity: Human, Rat, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's CCR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CCR2 ccr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LIMVICYSGI LKTLLRCRNE KKRHRAVRVI FTIMIVYFLF WTPYNIVILL. It is sometimes possible for the material contained within the vial of "CCR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.