Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Lung)

Rabbit CCNH Polyclonal Antibody | anti-CCNH antibody

CCNH antibody - C-terminal region

Gene Names
CCNH; CAK; p34; p37; CycH
Reactivity
Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
CCNH; Polyclonal Antibody; CCNH antibody - C-terminal region; anti-CCNH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL
Sequence Length
323
Applicable Applications for anti-CCNH antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 83%; Rabbit: 83%; Rat: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CCNH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Lung)

Immunohistochemistry (IHC) (Human Lung)

Western Blot (WB)

(WB Suggested Anti-CCNH Antibody Titration: 1ug/mlPositive Control: Jurkat cell lysateCCNH is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-CCNH Antibody Titration: 1ug/mlPositive Control: Jurkat cell lysateCCNH is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-CCNH antibody
This is a rabbit polyclonal antibody against CCNH. It was validated on Western Blot and immunohistochemistry

Target Description: Cyclin H regulates CDK7, the catalytic subunit of the CDK- activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDC2/CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive carboxyl-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. It is involved in cell cycle control and in RNA transcription by RNA polymerase II. Its expression and activity are constant throughout the cell cycle.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
902
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
cyclin-H isoform 1
NCBI Official Synonym Full Names
cyclin H
NCBI Official Symbol
CCNH
NCBI Official Synonym Symbols
CAK; p34; p37; CycH
NCBI Protein Information
cyclin-H
UniProt Protein Name
Cyclin-H
Protein Family
UniProt Gene Name
CCNH
UniProt Entry Name
CCNH_HUMAN

NCBI Description

The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. This cyclin forms a complex with CDK7 kinase and ring finger protein MAT1. The kinase complex is able to phosphorylate CDK2 and CDC2 kinases, thus functions as a CDK-activating kinase (CAK). This cyclin and its kinase partner are components of TFIIH, as well as RNA polymerase II protein complexes. They participate in two different transcriptional regulation processes, suggesting an important link between basal transcription control and the cell cycle machinery. A pseudogene of this gene is found on chromosome 4. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Nov 2010]

Uniprot Description

CCNH: Regulates CDK7, the catalytic subunit of the CDK- activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Involved in cell cycle control and in RNA transcription by RNA polymerase II. Its expression and activity are constant throughout the cell cycle. Associates primarily with CDK7 and MAT1 to form the CAK complex. CAK can further associate with the core-TFIIH to form the TFIIH basal transcription factor. Belongs to the cyclin family. Cyclin C subfamily.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 5q13.3-q14

Cellular Component: nucleoplasm; holo TFIIH complex; nucleus; cyclin-dependent protein kinase activating kinase holoenzyme complex

Molecular Function: RNA polymerase subunit kinase activity; DNA-dependent ATPase activity; protein binding; cyclin-dependent protein kinase regulator activity; protein kinase binding

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; viral reproduction; positive regulation of viral transcription; RNA elongation from RNA polymerase I promoter; transcription from RNA polymerase I promoter; DNA repair; termination of RNA polymerase I transcription; regulation of gene expression, epigenetic; protein amino acid phosphorylation; mRNA capping; negative regulation of gene expression, epigenetic; nucleotide-excision repair; transcription-coupled nucleotide-excision repair; RNA elongation from RNA polymerase II promoter; nucleotide-excision repair, DNA damage removal; gene expression; positive regulation of transcription from RNA polymerase II promoter; mitotic cell cycle; regulation of cyclin-dependent protein kinase activity; G2/M transition of mitotic cell cycle; transcription initiation from RNA polymerase I promoter; G1/S transition of mitotic cell cycle

Research Articles on CCNH

Similar Products

Product Notes

The CCNH ccnh (Catalog #AAA3224378) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCNH antibody - C-terminal region reacts with Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CCNH can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CCNH ccnh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KQKLERCHSA ELALNVITKK RKGYEDDDYV SKKSKHEEEE WTDDDLVESL. It is sometimes possible for the material contained within the vial of "CCNH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.