Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CCNCSample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CCNC Polyclonal Antibody | anti-CCNC antibody

CCNC Antibody - C-terminal region

Gene Names
CCNC; CycC; SRB11; hSRB11
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CCNC; Polyclonal Antibody; CCNC Antibody - C-terminal region; anti-CCNC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYS
Sequence Length
283
Applicable Applications for anti-CCNC antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CCNC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CCNCSample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CCNCSample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CCNC antibody
The protein encoded by this gene is a member of the cyclin family of proteins. The encoded protein interacts with cyclin-dependent kinase 8 and induces the phophorylation of the carboxy-terminal domain of the large subunit of RNA polymerase II. The level of mRNAs for this gene peaks in the G1 phase of the cell cycle. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-CCNC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
892
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31 kDa
NCBI Official Full Name
cyclin-C isoform b
NCBI Official Synonym Full Names
cyclin C
NCBI Official Symbol
CCNC
NCBI Official Synonym Symbols
CycC; SRB11; hSRB11
NCBI Protein Information
cyclin-C
UniProt Protein Name
Cyclin-C
UniProt Gene Name
CCNC
UniProt Synonym Gene Names
hSRB11
UniProt Entry Name
CCNC_HUMAN

NCBI Description

The protein encoded by this gene is a member of the cyclin family of proteins. The encoded protein interacts with cyclin-dependent kinase 8 and induces the phophorylation of the carboxy-terminal domain of the large subunit of RNA polymerase II. The level of mRNAs for this gene peaks in the G1 phase of the cell cycle. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CCNC: Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Binds to and activates cyclin-dependent kinase CDK8 that phosphorylates the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAp II), which may inhibit the formation of a transcription initiation complex. Belongs to the cyclin family. Cyclin C subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 6q21

Cellular Component: nucleoplasm; Srb-mediator complex; DNA-directed RNA polymerase II, holoenzyme

Molecular Function: protein binding; protein kinase binding

Biological Process: transcription initiation from RNA polymerase II promoter; Notch signaling pathway; transcription, DNA-dependent; transforming growth factor beta receptor signaling pathway; gene expression; positive regulation of transcription from RNA polymerase II promoter; regulation of cyclin-dependent protein kinase activity

Research Articles on CCNC

Similar Products

Product Notes

The CCNC ccnc (Catalog #AAA3221105) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCNC Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCNC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CCNC ccnc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RVILKLYEQW KNFDERKEMA TILSKMPKPK PPPNSEGEQG PNGSQNSSYS. It is sometimes possible for the material contained within the vial of "CCNC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.