Western Blot (WB)
(Western Blot analysis of CCNB1IP1 expression in transfected 293T cell line by CCNB1IP1 polyclonal antibody. Lane 1: CCNB1IP1 transfected lysate (31.5kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human CCNB1IP1 Polyclonal Antibody | anti-CCNB1IP1 antibody
CCNB1IP1 (E3 Ubiquitin-protein Ligase CCNB1IP1, Cyclin-B1-interacting Protein 1, Human Enhancer of Invasion 10, C14orf18, HEI10) APC
Gene Names
CCNB1IP1; HEI10; C14orf18
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CCNB1IP1; Polyclonal Antibody; CCNB1IP1 (E3 Ubiquitin-protein Ligase CCNB1IP1; Cyclin-B1-interacting Protein 1; Human Enhancer of Invasion 10; C14orf18; HEI10) APC; anti-CCNB1IP1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CCNB1IP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
277
Applicable Applications for anti-CCNB1IP1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CCNB1IP1, aa1-277 (NP_878269.1).
Immunogen Sequence
MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSEEYKAMVLAGLRPEIVLDISSRALAFWTYQVHQERLYQEYNFSKAEGHLKQMEKIYTQQIQSKDVELTSMKGEVTSMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDSLRLRNITIANHEGTLEPSMIAQSGVLGFPLGNNSKFPLDNTPVRNRGDGDGDFQFRPFFAGSPTAPEPSNSFFSFVSPSRELEQQQVSSRAFKVKRI
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of CCNB1IP1 expression in transfected 293T cell line by CCNB1IP1 polyclonal antibody. Lane 1: CCNB1IP1 transfected lysate (31.5kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of CCNB1IP1 expression in transfected 293T cell line by CCNB1IP1 polyclonal antibody. Lane 1: CCNB1IP1 transfected lysate (31.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CCNB1IP1 antibody
E3 ubiquitin-protein ligase. Modulates cyclin B levels and participates in the regulation of cell cycle progression through the G2 phase. Overexpression causes delayed entry into mitosis.
Product Categories/Family for anti-CCNB1IP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
E3 ubiquitin-protein ligase CCNB1IP1
NCBI Official Synonym Full Names
cyclin B1 interacting protein 1
NCBI Official Symbol
CCNB1IP1
NCBI Official Synonym Symbols
HEI10; C14orf18
NCBI Protein Information
E3 ubiquitin-protein ligase CCNB1IP1
UniProt Protein Name
E3 ubiquitin-protein ligase CCNB1IP1
Protein Family
UniProt Gene Name
CCNB1IP1
UniProt Synonym Gene Names
C14orf18; HEI10
UniProt Entry Name
CIP1_HUMAN
NCBI Description
HEI10 is a member of the E3 ubiquitin ligase family and functions in progression of the cell cycle through G(2)/M.[supplied by OMIM, Apr 2004]
Uniprot Description
CCNB1IP1: E3 ubiquitin-protein ligase. Modulates cyclin B levels and participates in the regulation of cell cycle progression through the G2 phase. Overexpression causes delayed entry into mitosis.
Protein type: Ligase; Motility/polarity/chemotaxis; Ubiquitin conjugating system; Cell cycle regulation; EC 6.3.2.19; Ubiquitin ligase; EC 6.3.2.-
Chromosomal Location of Human Ortholog: 14q11.2
Cellular Component: synaptonemal complex
Molecular Function: protein binding; zinc ion binding; ligase activity
Biological Process: meiotic recombination; protein ubiquitination; blastocyst formation; chiasma formation; spermatid development
Research Articles on CCNB1IP1
1. HEI10 defines a divergent class of E3 ubiquitin ligase, functioning in progression through G(2)/M.
Similar Products
Product Notes
The CCNB1IP1 ccnb1ip1 (Catalog #AAA6372642) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCNB1IP1 (E3 Ubiquitin-protein Ligase CCNB1IP1, Cyclin-B1-interacting Protein 1, Human Enhancer of Invasion 10, C14orf18, HEI10) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCNB1IP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CCNB1IP1 ccnb1ip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCNB1IP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
