Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CCL27 expression in transfected 293T cell line by CCL27 polyclonal antibody. Lane 1: CCL27 transfected lysate (12.6kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CCL27 Polyclonal Antibody | anti-CCL27 antibody

CCL27 (ILC, SCYA27, C-C Motif Chemokine 27, CC Chemokine ILC, Cutaneous T-cell-attracting Chemokine, ESkine, IL-11 R-alpha-locus Chemokine, Skinkine, Small-inducible Cytokine A27) (AP)

Gene Names
CCL27; ALP; ILC; CTAK; CTACK; PESKY; ESKINE; SCYA27
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CCL27; Polyclonal Antibody; CCL27 (ILC; SCYA27; C-C Motif Chemokine 27; CC Chemokine ILC; Cutaneous T-cell-attracting Chemokine; ESkine; IL-11 R-alpha-locus Chemokine; Skinkine; Small-inducible Cytokine A27) (AP); anti-CCL27 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CCL27.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-CCL27 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CCL27, aa1-112 (NP_006655.1).
Immunogen Sequence
MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CCL27 expression in transfected 293T cell line by CCL27 polyclonal antibody. Lane 1: CCL27 transfected lysate (12.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CCL27 expression in transfected 293T cell line by CCL27 polyclonal antibody. Lane 1: CCL27 transfected lysate (12.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CCL27 antibody
This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene is chemotactic for skin-associated memory T lymphocytes. This cytokine may also play a role in mediating homing of lymphocytes to cutaneous sites. It specifically binds to chemokine receptor 10 (CCR10). Studies of a similar murine protein indicate that these protein-receptor interactions have a pivotal role in T cell-mediated skin inflammation.
Product Categories/Family for anti-CCL27 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12,618 Da
NCBI Official Full Name
C-C motif chemokine 27
NCBI Official Synonym Full Names
chemokine (C-C motif) ligand 27
NCBI Official Symbol
CCL27
NCBI Official Synonym Symbols
ALP; ILC; CTAK; CTACK; PESKY; ESKINE; SCYA27
NCBI Protein Information
C-C motif chemokine 27; skinkine; CC chemokine ILC; IL-11 Ralpha-locus chemokine; small-inducible cytokine A27; IL-11 R-alpha-locus chemokine; cutaneous T-cell attracting chemokine; cutaneous T-cell-attracting chemokine; small inducible cytokine subfamily
UniProt Protein Name
C-C motif chemokine 27
Protein Family
UniProt Gene Name
CCL27
UniProt Synonym Gene Names
ILC; SCYA27; CTACK
UniProt Entry Name
CCL27_HUMAN

NCBI Description

This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene is chemotactic for skin-associated memory T lymphocytes. This cytokine may also play a role in mediating homing of lymphocytes to cutaneous sites. It specifically binds to chemokine receptor 10 (CCR10). Studies of a similar murine protein indicate that these protein-receptor interactions have a pivotal role in T cell-mediated skin inflammation. [provided by RefSeq, Jul 2008]

Uniprot Description

CCL27: Chemotactic factor that attracts skin-associated memory T-lymphocytes. May play a role in mediating homing of lymphocytes to cutaneous sites. May play a role in cell migration during embryogenesis. Nuclear forms may facilitate cellular migration by inducing cytoskeletal relaxation. Binds to CCR10. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Chemokine; Secreted, signal peptide; Motility/polarity/chemotaxis; Secreted

Chromosomal Location of Human Ortholog: 9p13

Cellular Component: extracellular space; extracellular region

Molecular Function: chemokine activity

Biological Process: cell-cell signaling; immune response; chemotaxis

Research Articles on CCL27

Similar Products

Product Notes

The CCL27 ccl27 (Catalog #AAA6372608) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCL27 (ILC, SCYA27, C-C Motif Chemokine 27, CC Chemokine ILC, Cutaneous T-cell-attracting Chemokine, ESkine, IL-11 R-alpha-locus Chemokine, Skinkine, Small-inducible Cytokine A27) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCL27 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CCL27 ccl27 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCL27, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.