Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence analysis of A549 cells using CCL26 antibody. Blue: DAPI for nuclear staining.)

Rabbit anti-Human CCL26 Polyclonal Antibody | anti-CCL26 antibody

CCL26 Polyclonal Antibody

Gene Names
CCL26; IMAC; TSC-1; MIP-4a; SCYA26; MIP-4alpha
Reactivity
Human
Applications
Immunofluorescence
Purity
Affinity Purification
Synonyms
CCL26; Polyclonal Antibody; CCL26 Polyclonal Antibody; IMAC; MIP-4a; MIP-4alpha; SCYA26; TSC-1; anti-CCL26 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
Sequence Length
94
Applicable Applications for anti-CCL26 antibody
Immunofluorescence (IF)
Application Notes
IF: 1:50 - 1:200
Immunogen
A synthetic peptide of human CCL26
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Secreted
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Immunofluorescence (IF)

(Immunofluorescence analysis of A549 cells using CCL26 antibody. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of A549 cells using CCL26 antibody. Blue: DAPI for nuclear staining.)
Related Product Information for anti-CCL26 antibody
This gene is one of two Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 7. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for normal peripheral blood eosinophils and basophils. The product of this gene is one of three related chemokines that specifically activate chemokine receptor CCR3. This chemokine may contribute to the eosinophil accumulation in atopic diseases.
Product Categories/Family for anti-CCL26 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
C-C motif chemokine 26
NCBI Official Synonym Full Names
C-C motif chemokine ligand 26
NCBI Official Symbol
CCL26
NCBI Official Synonym Symbols
IMAC; TSC-1; MIP-4a; SCYA26; MIP-4alpha
NCBI Protein Information
C-C motif chemokine 26
UniProt Protein Name
C-C motif chemokine 26
Protein Family
UniProt Gene Name
CCL26
UniProt Synonym Gene Names
SCYA26; MIP-4-alpha; TSC-1

NCBI Description

This gene is one of two Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 7. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for normal peripheral blood eosinophils and basophils. The product of this gene is one of three related chemokines that specifically activate chemokine receptor CCR3. This chemokine may contribute to the eosinophil accumulation in atopic diseases. [provided by RefSeq, Jul 2008]

Uniprot Description

Chemoattractant for eosinophils and basophils (PubMed:10415065, PubMed:10488147). Acts as a ligand for C-C chemokine receptor CCR3 which triggers Ca2+ mobilization in eosinophils (PubMed:10415065, PubMed:10488147, PubMed:11425309).

Research Articles on CCL26

Similar Products

Product Notes

The CCL26 ccl26 (Catalog #AAA9132900) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCL26 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCL26 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF). IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the CCL26 ccl26 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TRGSDISKTC CFQYSHKPLP WTWVRSYEFT SNSCSQRAVI FTTKRGKKVC THPRKKWVQK YISLLKTPKQ L. It is sometimes possible for the material contained within the vial of "CCL26, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.