Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CCL11Sample Tissue: Human Mouse Small IntestineAntibody Dilution: 1ug/ml)

Rabbit Ccl11 Polyclonal Antibody | anti-CCL11 antibody

Ccl11 antibody - C-terminal region

Gene Names
Ccl11; Scya11; eotaxin
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Ccl11; Polyclonal Antibody; Ccl11 antibody - C-terminal region; anti-CCL11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTP
Sequence Length
97
Applicable Applications for anti-CCL11 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 87%; Horse: 100%; Human: 100%; Mouse: 90%; Pig: 92%; Rabbit: 91%; Rat: 90%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CCL11Sample Tissue: Human Mouse Small IntestineAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CCL11Sample Tissue: Human Mouse Small IntestineAntibody Dilution: 1ug/ml)
Related Product Information for anti-CCL11 antibody
This is a rabbit polyclonal antibody against Ccl11. It was validated on Western Blot

Target Description: In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils (a prominent feature of allergic inflammatory reactions), but not lymphocytes, macrophages or neutrophils.
Product Categories/Family for anti-CCL11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
eotaxin
NCBI Official Synonym Full Names
chemokine (C-C motif) ligand 11
NCBI Official Symbol
Ccl11
NCBI Official Synonym Symbols
Scya11; eotaxin
NCBI Protein Information
eotaxin
UniProt Protein Name
Eotaxin
Protein Family
UniProt Gene Name
Ccl11
UniProt Synonym Gene Names
Scya11
UniProt Entry Name
CCL11_MOUSE

Uniprot Description

CCL11: In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions. Binds to CCR3. Belongs to the intercrine beta (chemokine CC) family.

Protein type: Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide

Cellular Component: extracellular space; extracellular region; intracellular

Molecular Function: chemokine activity; cytokine activity

Biological Process: regulation of cell shape; positive regulation of angiogenesis; positive regulation of actin filament polymerization; mast cell chemotaxis; eosinophil chemotaxis; actin filament organization; immune response; cytoskeleton organization and biogenesis; positive regulation of endothelial cell proliferation; chemotaxis; inflammatory response; positive regulation of cell migration

Research Articles on CCL11

Similar Products

Product Notes

The CCL11 ccl11 (Catalog #AAA3200300) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ccl11 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Ccl11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CCL11 ccl11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LKSYKRITNN RCTLKAIVFK TRLGKEICAD PKKKWVQDAT KHLDQKLQTP. It is sometimes possible for the material contained within the vial of "Ccl11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.