Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CCKBRSample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CCKBR Polyclonal Antibody | anti-CCKBR antibody

CCKBR Antibody - C-terminal region

Gene Names
CCKBR; GASR; CCK-B; CCK2R
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CCKBR; Polyclonal Antibody; CCKBR Antibody - C-terminal region; anti-CCKBR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PLVYCFMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRL
Sequence Length
447
Applicable Applications for anti-CCKBR antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CCKBR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CCKBRSample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CCKBRSample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CCKBR antibody
This gene encodes a G-protein coupled receptor for gastrin and cholecystokinin (CCK), regulatory peptides of the brain and gastrointestinal tract. This protein is a type B gastrin receptor, which has a high affinity for both sulfated and nonsulfated CCK analogs and is found principally in the central nervous system and the gastrointestinal tract. Alternative splicing results in multiple transcript variants. A misspliced transcript variant including an intron has been observed in cells from colorectal and pancreatic tumors.
Product Categories/Family for anti-CCKBR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
887
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49 kDa
NCBI Official Full Name
gastrin/cholecystokinin type B receptor isoform 1
NCBI Official Synonym Full Names
cholecystokinin B receptor
NCBI Official Symbol
CCKBR
NCBI Official Synonym Symbols
GASR; CCK-B; CCK2R
NCBI Protein Information
gastrin/cholecystokinin type B receptor
UniProt Protein Name
Gastrin/cholecystokinin type B receptor
UniProt Gene Name
CCKBR
UniProt Synonym Gene Names
CCKRB; CCK-B receptor; CCK-BR; CCK2-R
UniProt Entry Name
GASR_HUMAN

NCBI Description

This gene encodes a G-protein coupled receptor for gastrin and cholecystokinin (CCK), regulatory peptides of the brain and gastrointestinal tract. This protein is a type B gastrin receptor, which has a high affinity for both sulfated and nonsulfated CCK analogs and is found principally in the central nervous system and the gastrointestinal tract. Alternative splicing results in multiple transcript variants. A misspliced transcript variant including an intron has been observed in cells from colorectal and pancreatic tumors. [provided by RefSeq, Dec 2015]

Uniprot Description

CCKBR: Receptor for gastrin and cholecystokinin. The CKK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Belongs to the G-protein coupled receptor 1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR

Chromosomal Location of Human Ortholog: 11p15.4

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: type B gastrin/cholecystokinin receptor binding; protein binding; gastrin receptor activity; 1-phosphatidylinositol-3-kinase regulator activity; cholecystokinin receptor activity; phosphoinositide phospholipase C activity

Biological Process: gastric acid secretion; gland development; metabolic process; regulation of phosphoinositide 3-kinase activity; cell proliferation; elevation of cytosolic calcium ion concentration; cell surface receptor linked signal transduction; gut development; sensory perception; positive regulation of cell proliferation; digestion; feeding behavior; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating)

Research Articles on CCKBR

Similar Products

Product Notes

The CCKBR cckbr (Catalog #AAA3221519) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCKBR Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCKBR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CCKBR cckbr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PLVYCFMHRR FRQACLETCA RCCPRPPRAR PRALPDEDPP TPSIASLSRL. It is sometimes possible for the material contained within the vial of "CCKBR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.