<
Western Blot (WB)
(Host: RabbitTarget Name: CCDC90ASample Type: Human Fetal LungLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)
Rabbit CCDC90A Polyclonal Antibody | anti-MCUR1 antibody
CCDC90A antibody - middle region
Gene Names
MCUR1; FMP32; C6orf79; CCDC90A
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CCDC90A; Polyclonal Antibody; CCDC90A antibody - middle region; anti-MCUR1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELHQLKQQVMDEVIKVRTDTKLDFNLEKSRVKELYSLNEKKLLELRTEIV
Sequence Length
359
Applicable Applications for anti-MCUR1 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CCDC90A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: CCDC90ASample Type: Human Fetal LungLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)
Western Blot (WB)
(Host: RabbitTarget Name: CCDC90ASample Type: Human Fetal LungLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)
Western Blot (WB)
(Host: RabbitTarget Name: MCUR1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: MCUR1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: MCUR1Sample Type: OVCAR-3 Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: MCUR1Sample Type: OVCAR-3 Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-CCDC90A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)
Western Blot (WB)
(WB Suggested Anti-CCDC90A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human brain)
Related Product Information for anti-MCUR1 antibody
This is a rabbit polyclonal antibody against CCDC90A. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism.
Target Description: Essential component of mitochondrial Ca2+ uptake that regulates cellular metabolism.
Product Categories/Family for anti-MCUR1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
mitochondrial calcium uniporter regulator 1
NCBI Official Synonym Full Names
mitochondrial calcium uniporter regulator 1
NCBI Official Symbol
MCUR1
NCBI Official Synonym Symbols
FMP32; C6orf79; CCDC90A
NCBI Protein Information
mitochondrial calcium uniporter regulator 1
UniProt Protein Name
Mitochondrial calcium uniporter regulator 1
Protein Family
UniProt Gene Name
MCUR1
UniProt Synonym Gene Names
C6orf79; CCDC90A
UniProt Entry Name
MCUR1_HUMAN
Research Articles on MCUR1
Similar Products
Product Notes
The MCUR1 mcur1 (Catalog #AAA3207528) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCDC90A antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CCDC90A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MCUR1 mcur1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELHQLKQQVM DEVIKVRTDT KLDFNLEKSR VKELYSLNEK KLLELRTEIV. It is sometimes possible for the material contained within the vial of "CCDC90A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
