Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-CCDC47 Polyclonal Antibody)

Rabbit CCDC47 Polyclonal Antibody | anti-CCDC47 antibody

CCDC47 Polyclonal Antibody

Gene Names
CCDC47; THNS; GK001; MSTP041
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CCDC47; Polyclonal Antibody; CCDC47 Polyclonal Antibody; GK001; MSTP041; coiled-coil domain containing 47; anti-CCDC47 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.15 mg/ml (varies by lot)
Sequence Length
483
Applicable Applications for anti-CCDC47 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 224-483 of human CCDC47 (NP_064583.2).
Immunogen Sequence
FLKRQDLLNVLARMMRPVSDQVQIKVTMNDEDMDTYVFAVGTRKALVRLQKEMQDLSEFCSDKPKSGAKYGLPDSLAILSEMGEVTDGMMDTKMVHFLTHYADKIESVHFSDQFSGPKIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYPKDMEALLPLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAEKERIMNEEDPEKQRRLEEAALRREQKKLEKKQMKMKQIKVKAM
Positive Samples
LO2, OVCAR3, Mouse Lung
Cellular Location
Membrane, Single-Pass Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-CCDC47 Polyclonal Antibody)

Western Blot (WB) (Western blot-CCDC47 Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated: 55kDa
Observed: 60kDa
NCBI Official Full Name
coiled-coil domain containing 47, isoform CRA_a
NCBI Official Synonym Full Names
coiled-coil domain containing 47
NCBI Official Symbol
CCDC47
NCBI Official Synonym Symbols
THNS; GK001; MSTP041
NCBI Protein Information
coiled-coil domain-containing protein 47
UniProt Protein Name
Coiled-coil domain-containing protein 47
UniProt Gene Name
CCDC47
UniProt Entry Name
CCD47_HUMAN

Uniprot Description

CCDC47: 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 17q23.3

Cellular Component: membrane; endoplasmic reticulum; integral to membrane

Molecular Function: protein binding; calcium ion binding

Biological Process: calcium ion homeostasis; osteoblast differentiation; ER overload response; post-embryonic development

Research Articles on CCDC47

Similar Products

Product Notes

The CCDC47 ccdc47 (Catalog #AAA9140574) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCDC47 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CCDC47 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the CCDC47 ccdc47 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CCDC47, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.