Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CCBE1 expression in transfected 293T cell line by CCBE1 polyclonal antibody. Lane 1: CCBE1 transfected lysate (23.65kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human CCBE1 Polyclonal Antibody | anti-CCBE1 antibody

CCBE1 (KIAA1983, Collagen and Calcium-binding EGF Domain-containing Protein 1, Full of Fluid Protein Homolog, FLJ30681, MGC50861, UNQ1921/PRO4395)

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CCBE1; Polyclonal Antibody; CCBE1 (KIAA1983; Collagen and Calcium-binding EGF Domain-containing Protein 1; Full of Fluid Protein Homolog; FLJ30681; MGC50861; UNQ1921/PRO4395); Anti -CCBE1 (KIAA1983; anti-CCBE1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CCBE1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MVKAGTCCATCKEFYQMKQTVLQLKQKIALLPNNAADLGKYITGDKVLASNTYLPGPPGLPGGQGPPGSPGPKGSPGFPGMPGPPGQPGPRGSMGPMGPSPDLSHIKQGRRGPVGPPGAPGRDGSKGERGAPGPRGSPGPPGSFDFLLLMLADIRNDITELQEKVFGHRTHSSAEEFPLPQEFPSYPEAMDLGSGDDHPRRTETRDLRAPRDFYP
Applicable Applications for anti-CCBE1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human CCBE1, aa1-215 (AAH46645).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CCBE1 expression in transfected 293T cell line by CCBE1 polyclonal antibody. Lane 1: CCBE1 transfected lysate (23.65kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CCBE1 expression in transfected 293T cell line by CCBE1 polyclonal antibody. Lane 1: CCBE1 transfected lysate (23.65kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CCBE1 antibody
This gene is thought to function in extracellular matrix remodeling and migration. It is predominantly expressed in the ovary, but down regulated in ovarian cancer cell lines and primary carcinomas, suggesting its role as a tumour suppressor. Mutations in this gene have been associated with Hennekam lymphangiectasia-lymphedema syndrome, a generalized lymphatic dysplasia in humans.
Product Categories/Family for anti-CCBE1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,103 Da
NCBI Official Full Name
collagen and calcium-binding EGF domain-containing protein 1
NCBI Official Synonym Full Names
collagen and calcium binding EGF domains 1
NCBI Official Symbol
CCBE1
NCBI Protein Information
collagen and calcium-binding EGF domain-containing protein 1; full of fluid protein homolog
UniProt Protein Name
Collagen and calcium-binding EGF domain-containing protein 1
UniProt Gene Name
CCBE1
UniProt Synonym Gene Names
KIAA1983
UniProt Entry Name
CCBE1_HUMAN

NCBI Description

This gene is thought to function in extracellular matrix remodeling and migration. It is predominantly expressed in the ovary, but down regulated in ovarian cancer cell lines and primary carcinomas, suggesting its role as a tumour suppressor. Mutations in this gene have been associated with Hennekam lymphangiectasia-lymphedema syndrome, a generalized lymphatic dysplasia in humans. [provided by RefSeq, Mar 2010]

Uniprot Description

CCBE1: Required for lymphangioblast budding and angiogenic sprouting from venous endothelium during embryogenesis. Defects in CCBE1 are the cause of Hennekam lymphangiectasia-lymphedema syndrome (HLLS). HLLS is a generalized lymph-vessels dysplasia characterized by intestinal lymphangiectasia with severe lymphedema of the limbs, genitalia and face. In addition, affected individuals have unusual facies and severe mental retardation. Belongs to the CCBE1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 18q21.32

Cellular Component: proteinaceous extracellular matrix; extracellular space; collagen

Molecular Function: collagen binding; protease binding; calcium ion binding

Biological Process: positive regulation of angiogenesis; venous blood vessel morphogenesis; lymphangiogenesis; sprouting angiogenesis

Disease: Hennekam Lymphangiectasia-lymphedema Syndrome 1

Research Articles on CCBE1

Similar Products

Product Notes

The CCBE1 ccbe1 (Catalog #AAA643986) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CCBE1 (KIAA1983, Collagen and Calcium-binding EGF Domain-containing Protein 1, Full of Fluid Protein Homolog, FLJ30681, MGC50861, UNQ1921/PRO4395) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CCBE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the CCBE1 ccbe1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVKAGTCCAT CKEFYQMKQT VLQLKQKIAL LPNNAADLGK YITGDKVLAS NTYLPGPPGL PGGQGPPGSP GPKGSPGFPG MPGPPGQPGP RGSMGPMGPS PDLSHIKQGR RGPVGPPGAP GRDGSKGERG APGPRGSPGP PGSFDFLLLM LADIRNDITE LQEKVFGHRT HSSAEEFPLP QEFPSYPEAM DLGSGDDHPR RTETRDLRAP RDFYP. It is sometimes possible for the material contained within the vial of "CCBE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.