Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CBR3Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit CBR3 Polyclonal Antibody | anti-CBR3 antibody

CBR3 Antibody - middle region

Gene Names
CBR3; hCBR3; SDR21C2; HEL-S-25
Reactivity
Cow, Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
CBR3; Polyclonal Antibody; CBR3 Antibody - middle region; anti-CBR3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDL
Sequence Length
277
Applicable Applications for anti-CBR3 antibody
Western Blot (WB)
Homology
Cow: 79%; Human: 100%; Rabbit: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human CBR3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CBR3Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CBR3Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CBR3 antibody
This is a rabbit polyclonal antibody against CBR3. It was validated on Western Blot

Target Description: Carbonyl reductase 3 catalyzes the reduction of a large number of biologically and pharmacologically active carbonyl compounds to their corresponding alcohols. The enzyme is classified as a monomeric NADPH-dependent oxidoreductase. CBR3 contains three exons spanning 11.2 kilobases and is closely linked to another carbonyl reductase gene - CBR1.
Product Categories/Family for anti-CBR3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
874
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
carbonyl reductase
NCBI Official Synonym Full Names
carbonyl reductase 3
NCBI Official Symbol
CBR3
NCBI Official Synonym Symbols
hCBR3; SDR21C2; HEL-S-25
NCBI Protein Information
carbonyl reductase [NADPH] 3
UniProt Protein Name
Carbonyl reductase [NADPH] 3
Protein Family
UniProt Gene Name
CBR3
UniProt Entry Name
CBR3_HUMAN

NCBI Description

Carbonyl reductase 3 catalyzes the reduction of a large number of biologically and pharmacologically active carbonyl compounds to their corresponding alcohols. The enzyme is classified as a monomeric NADPH-dependent oxidoreductase. CBR3 contains three exons spanning 11.2 kilobases and is closely linked to another carbonyl reductase gene - CBR1. [provided by RefSeq, Jul 2008]

Uniprot Description

CBR3: Has low NADPH-dependent oxidoreductase activity towards 4-benzoylpyridine and menadione (in vitro). Belongs to the short-chain dehydrogenases/reductases (SDR) family.

Protein type: Oxidoreductase; EC 1.1.1.184; Lipid Metabolism - arachidonic acid

Chromosomal Location of Human Ortholog: 21q22.2

Cellular Component: nucleoplasm; extracellular space; cytoplasm; cytosol

Molecular Function: 3-keto sterol reductase activity; carbonyl reductase (NADPH) activity

Biological Process: phylloquinone catabolic process; cognition

Research Articles on CBR3

Similar Products

Product Notes

The CBR3 cbr3 (Catalog #AAA3207918) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CBR3 Antibody - middle region reacts with Cow, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CBR3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CBR3 cbr3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CNELLPIMKP HGRVVNISSL QCLRAFENCS EDLQERFHSE TLTEGDLVDL. It is sometimes possible for the material contained within the vial of "CBR3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.