Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CASP2Sample Tissue: Mouse Pancreas lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse CASP2 Polyclonal Antibody | anti-CASP2 antibody

CASP2 Antibody - middle region

Gene Names
Casp2; ICH-1; Nedd2; CASP-2; NEDD-2
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
CASP2; Polyclonal Antibody; CASP2 Antibody - middle region; anti-CASP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 5% sucrose.
Sequence
Synthetic peptide located within the following region: RLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHTQSPGCEESD
Sequence Length
452
Applicable Applications for anti-CASP2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse CASP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -23C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CASP2Sample Tissue: Mouse Pancreas lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CASP2Sample Tissue: Mouse Pancreas lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CASP2 antibody
This gene encodes the evolutionarily ancient and most conserved member of the cysteine proteases that plays important role in stress-induced apoptosis, DNA repair and tumor suppression. Mice lacking the encoded protein develop normally but display cell type-specific apoptotic defects. Germ cells and oocytes from such mice were found to be resistant to cell death after treatment with chemotherapeutic drugs.
Product Categories/Family for anti-CASP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49 kDa
NCBI Official Synonym Full Names
caspase 2
NCBI Official Symbol
Casp2
NCBI Official Synonym Symbols
ICH-1; Nedd2; CASP-2; NEDD-2
NCBI Protein Information
caspase-2
UniProt Protein Name
Caspase-2
Protein Family
UniProt Gene Name
Casp2
UniProt Synonym Gene Names
Ich1; Nedd-2; Nedd2; CASP-2; NEDD-2
UniProt Entry Name
CASP2_MOUSE

NCBI Description

This gene encodes the evolutionarily ancient and most conserved member of the cysteine proteases that plays important role in stress-induced apoptosis, DNA repair and tumor suppression. Mice lacking the encoded protein develop normally but display cell type-specific apoptotic defects. Germ cells and oocytes from such mice were found to be resistant to cell death after treatment with chemotherapeutic drugs. [provided by RefSeq, Apr 2015]

Uniprot Description

CASP2: Involved in the activation cascade of caspases responsible for apoptosis execution. Might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival. Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a p18 subunit and a p12 subunit. Interacts with LRDD. Expressed at higher levels in the embryonic lung, liver and kidney than in the heart and brain. In adults, higher level expression is seen in the placenta, lung, kidney, and pancreas than in the heart, brain, liver and skeletal muscle. Belongs to the peptidase C14A family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; EC 3.4.22.55; Protease

Cellular Component: mitochondrion; membrane; cytoplasm; intracellular; nucleus

Molecular Function: peptidase activity; protein domain specific binding; protein binding; hydrolase activity; cysteine-type endopeptidase activity; cysteine-type peptidase activity

Biological Process: caspase activation; regulation of apoptosis; DNA damage response, signal transduction resulting in induction of apoptosis; apoptosis; positive regulation of apoptosis; positive regulation of neuron apoptosis; germ cell programmed cell death; protein processing; proteolysis; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; negative regulation of apoptosis

Research Articles on CASP2

Similar Products

Product Notes

The CASP2 casp2 (Catalog #AAA3223718) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CASP2 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CASP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CASP2 casp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RLFDNANCPS LQNKPKMFFI QACRGDETDR GVDQQDGKNH TQSPGCEESD. It is sometimes possible for the material contained within the vial of "CASP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.