Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CARF Antibody Titration: 0.3125ug/mlPositive Control: Jurkat cell lysateCDKN2AIP is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit CARF Polyclonal Antibody | anti-CDKN2AIP antibody

CARF antibody - C-terminal region

Gene Names
CDKN2AIP; CARF
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
CARF; Polyclonal Antibody; CARF antibody - C-terminal region; anti-CDKN2AIP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AIEALKATLDVFFVPLKELADLPQNKSSQESIVCELRCKSVYLGTGCGKS
Sequence Length
580
Applicable Applications for anti-CDKN2AIP antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CARF
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CARF Antibody Titration: 0.3125ug/mlPositive Control: Jurkat cell lysateCDKN2AIP is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-CARF Antibody Titration: 0.3125ug/mlPositive Control: Jurkat cell lysateCDKN2AIP is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-CDKN2AIP antibody
This is a rabbit polyclonal antibody against CARF. It was validated on Western Blot and immunohistochemistry

Target Description: CARF was first cloned as a novel binding partner of ARF from a yeast-interactive screen. CARF and ARF colocalize in the perinucleolar region and have a collaborative function. In the nucleoplasm, CARF interacts with p53 and enhances its function. The p53 downregulates CARF in a negative feedback regulatory loop and may also involve p53 antagonist HDM2.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
CDKN2A-interacting protein isoform 1
NCBI Official Synonym Full Names
CDKN2A interacting protein
NCBI Official Symbol
CDKN2AIP
NCBI Official Synonym Symbols
CARF
NCBI Protein Information
CDKN2A-interacting protein
UniProt Protein Name
CDKN2A-interacting protein
UniProt Gene Name
CDKN2AIP
UniProt Synonym Gene Names
CARF
UniProt Entry Name
CARF_HUMAN

NCBI Description

The protein encoded by this gene regulates the DNA damage response through several different signaling pathways. One such pathway is the p53-HDM2-p21(WAF1) pathway, which is critical to the DNA damage response. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]

Uniprot Description

CDKN2AIP: co-localizes and interacts with p14ARF in the nucleolus. Co-regulated with ARF and cooperates with it in activating p53.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 4q35.1

Cellular Component: nucleoplasm; granular component; cytoplasm; nucleolus; nucleus

Molecular Function: protein binding; RNA binding; p53 binding

Biological Process: positive regulation of signal transduction; regulation of protein stability; negative regulation of cell growth; response to DNA damage stimulus; positive regulation of cell growth

Research Articles on CDKN2AIP

Similar Products

Product Notes

The CDKN2AIP cdkn2aip (Catalog #AAA3205518) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CARF antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CARF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the CDKN2AIP cdkn2aip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AIEALKATLD VFFVPLKELA DLPQNKSSQE SIVCELRCKS VYLGTGCGKS. It is sometimes possible for the material contained within the vial of "CARF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.