Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CAMKK1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)

Rabbit CAMKK1 Polyclonal Antibody | anti-CAMKK1 antibody

CAMKK1 antibody - C-terminal region

Gene Names
CAMKK1; CAMKKA
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CAMKK1; Polyclonal Antibody; CAMKK1 antibody - C-terminal region; anti-CAMKK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEEVKNSVRLIPSWTTVILVKSMLRKRSFGNPFEPQARREERSMSAPGNL
Sequence Length
520
Applicable Applications for anti-CAMKK1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CAMKK1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)

Western Blot (WB) (WB Suggested Anti-CAMKK1 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole Cell)
Related Product Information for anti-CAMKK1 antibody
This is a rabbit polyclonal antibody against CAMKK1. It was validated on Western Blot

Target Description: The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade. Three transcript variants encoding two distinct isoforms have been identified for this gene
Product Categories/Family for anti-CAMKK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
calcium/calmodulin-dependent protein kinase kinase 1 isoform b
NCBI Official Synonym Full Names
calcium/calmodulin dependent protein kinase kinase 1
NCBI Official Symbol
CAMKK1
NCBI Official Synonym Symbols
CAMKKA
NCBI Protein Information
calcium/calmodulin-dependent protein kinase kinase 1
UniProt Protein Name
Calcium/calmodulin-dependent protein kinase kinase 1
UniProt Gene Name
CAMKK1
UniProt Synonym Gene Names
CAMKKA; CaM-KK 1; CaM-kinase kinase 1; CaMKK 1; CaM-KK alpha; CaM-kinase kinase alpha; CaMKK alpha
UniProt Entry Name
KKCC1_HUMAN

NCBI Description

The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade. Three transcript variants encoding two distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

CAMKK1: a calcium/calmodulin-dependent S/T protein kinase of the CAMKK family. Phosphorylates CAMK1, CAMK1D, CAMK1G and CAMK4. Involved in regulating cell apoptosis. Promotes cell survival by phosphorylating AKT1/PKB that inhibits pro-apoptotic BAD/Bcl2-antagonist of cell death. 2 isoforms of the human protein are produced by alternative splicing. The autoinhibitory domain overlaps with the calmodulin binding region and may be involved in intrasteric autoinhibition. Binding of calmodulin may releave intrasteric autoinhibition. May be regulated through phosphorylation by CAMK1 and CAMK4. Appears to be autophosphorylated in a Ca2+/calmodulin-dependent manner. Phosphorylation of Ser-458 is blocked upon binding to Ca2+/calmodulin.

Protein type: Protein kinase, Ser/Thr (non-receptor); Protein kinase, Other; Kinase, protein; EC 2.7.11.17; Other group; CAMKK family; Meta subfamily

Chromosomal Location of Human Ortholog: 17p13.2

Cellular Component: nucleus; cytosol

Molecular Function: calmodulin binding; protein binding; calmodulin-dependent protein kinase activity; ATP binding

Biological Process: synaptic transmission; protein amino acid phosphorylation

Research Articles on CAMKK1

Similar Products

Product Notes

The CAMKK1 camkk1 (Catalog #AAA3214783) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CAMKK1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CAMKK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CAMKK1 camkk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEEVKNSVRL IPSWTTVILV KSMLRKRSFG NPFEPQARRE ERSMSAPGNL. It is sometimes possible for the material contained within the vial of "CAMKK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.