Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CADM3Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CADM3 Polyclonal Antibody | anti-CADM3 antibody

CADM3 Antibody - C-terminal region

Gene Names
CADM3; BIgR; NECL1; TSLL1; IGSF4B; Necl-1; synCAM3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CADM3; Polyclonal Antibody; CADM3 Antibody - C-terminal region; anti-CADM3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LIFLGHYLIRHKGTYLTHEAKGSDDAPDADTAIINAEGGQSGGDDKKEYF
Sequence Length
352
Applicable Applications for anti-CADM3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CADM3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CADM3Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CADM3Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CADM3 antibody
IGSF4B is a brain-specific protein related to the calcium-independent cell-cell adhesion molecules known as nectins.
Product Categories/Family for anti-CADM3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
cell adhesion molecule 3 isoform 2
NCBI Official Synonym Full Names
cell adhesion molecule 3
NCBI Official Symbol
CADM3
NCBI Official Synonym Symbols
BIgR; NECL1; TSLL1; IGSF4B; Necl-1; synCAM3
NCBI Protein Information
cell adhesion molecule 3
UniProt Protein Name
Cell adhesion molecule 3
Protein Family
UniProt Gene Name
CADM3
UniProt Synonym Gene Names
IGSF4B; NECL1; SYNCAM3; TSLL1; IgSF4B; NECL-1; SynCAM3; TSLL1
UniProt Entry Name
CADM3_HUMAN

NCBI Description

The protein encoded by this gene is a calcium-independent cell-cell adhesion protein that can form homodimers or heterodimers with other nectin proteins. The encoded protein has both homophilic and heterophilic cell-cell adhesion activity. This gene is reported to be a tumor suppressor gene. [provided by RefSeq, Oct 2016]

Uniprot Description

CADM3: Involved in the cell-cell adhesion. Has both calcium- independent homophilic cell-cell adhesion activity and calcium- independent heterophilic cell-cell adhesion activity with IGSF4, PVRL1 and PVRL3. Interaction with EPB41L1 may regulate structure or function of cell-cell junctions. Belongs to the nectin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 1q21.2-q22

Cellular Component: integral to membrane; plasma membrane; intercellular junction

Molecular Function: protein homodimerization activity

Biological Process: heterophilic cell adhesion; intercellular junction assembly and maintenance; protein localization; homophilic cell adhesion

Research Articles on CADM3

Similar Products

Product Notes

The CADM3 cadm3 (Catalog #AAA3222063) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CADM3 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CADM3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CADM3 cadm3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LIFLGHYLIR HKGTYLTHEA KGSDDAPDAD TAIINAEGGQ SGGDDKKEYF. It is sometimes possible for the material contained within the vial of "CADM3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.