Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CA2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)

Rabbit CA2 Polyclonal Antibody | anti-CA2 antibody

CA2 antibody - C-terminal region

Gene Names
CA2; CAC; CAII; Car2; CA-II; HEL-76; HEL-S-282
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CA2; Polyclonal Antibody; CA2 antibody - C-terminal region; anti-CA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFD
Sequence Length
260
Applicable Applications for anti-CA2 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Rabbit: 86%; Rat: 85%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CA2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CA2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-CA2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)
Related Product Information for anti-CA2 antibody
This is a rabbit polyclonal antibody against CA2. It was validated on Western Blot

Target Description: CA2 is essential for bone resorption and osteoclast differentiation. CA2 is implicated in reversible hydration of carbon dioxide. CA2 can hydrates cyanamide to urea. CA2 is involved in the regulation of fluid secretion into the anterior chamber of the eye.
Product Categories/Family for anti-CA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
760
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
carbonic anhydrase 2 isoform 1
NCBI Official Synonym Full Names
carbonic anhydrase 2
NCBI Official Symbol
CA2
NCBI Official Synonym Symbols
CAC; CAII; Car2; CA-II; HEL-76; HEL-S-282
NCBI Protein Information
carbonic anhydrase 2
UniProt Protein Name
Carbonic anhydrase 2
Protein Family
UniProt Gene Name
CA2
UniProt Synonym Gene Names
CAC; CA-II
UniProt Entry Name
CAH2_HUMAN

NCBI Description

The protein encoded by this gene is one of several isozymes of carbonic anhydrase, which catalyzes reversible hydration of carbon dioxide. Defects in this enzyme are associated with osteopetrosis and renal tubular acidosis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2014]

Uniprot Description

CA2: Essential for bone resorption and osteoclast differentiation. Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea. Involved in the regulation of fluid secretion into the anterior chamber of the eye. Interacts with SLC4A4. Interaction with SLC4A7 regulates SLC4A7 transporter activity. Activated by X-ray, histamine, L-adrenaline, L- and D-phenylalanine, L- and D-histidine, L-His-OMe and beta-Ala- His (carnosine). Competitively inhibited by saccharin, thioxolone, coumarins, 667-coumate, celecoxib (Celebrex), valdecoxib (Bextra), SC-125, SC-560, diclofenac, acetate, azide, bromide, sulfonamide derivatives such as acetazolamide (AZA), methazolamide (MZA), ethoxzolamide (EZA), dichlorophenamide (DCP), brinzolamide, dansylamide, thiabendazole-5-sulfonamide, trifluoromethane sulfonamide and N-hydroxysulfamide, fructose-based sugar sulfamate RWJ-37497, and Foscarnet (phosphonoformate trisodium salt). Repressed strongly by hydrogen sulfide(HS) and weakly by nitrate (NO(3)). Esterase activity weakly reduced by cyanamide. N- hydroxyurea interfers with zinc binding and inhibit activity. Belongs to the alpha-carbonic anhydrase family.

Protein type: Lyase; EC 4.2.1.1; Energy Metabolism - nitrogen

Chromosomal Location of Human Ortholog: 8q22

Cellular Component: extracellular space; microvillus; apical part of cell; axon; basolateral plasma membrane; cytoplasm; plasma membrane; cytosol; myelin sheath

Molecular Function: protein binding; carbonate dehydratase activity; zinc ion binding

Biological Process: secretion; positive regulation of osteoclast differentiation; positive regulation of synaptic transmission, GABAergic; positive regulation of cellular pH reduction; one-carbon compound metabolic process; odontogenesis of dentine-containing teeth; response to zinc ion; bicarbonate transport; response to estrogen stimulus; regulation of intracellular pH; positive regulation of bone resorption; morphogenesis of an epithelium; kidney development; response to pH

Disease: Osteopetrosis, Autosomal Recessive 3

Research Articles on CA2

Similar Products

Product Notes

The CA2 ca2 (Catalog #AAA3214651) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CA2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's CA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CA2 ca2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGKAVQQPDG LAVLGIFLKV GSAKPGLQKV VDVLDSIKTK GKSADFTNFD. It is sometimes possible for the material contained within the vial of "CA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.