Western Blot (WB)
(WB Suggested Anti-C3orf64 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Rabbit C3orf64 Polyclonal Antibody | anti-EOGT antibody
C3orf64 antibody - C-terminal region
Gene Names
EOGT; AOS4; AER61; EOGT1; C3orf64
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C3orf64; Polyclonal Antibody; C3orf64 antibody - C-terminal region; anti-EOGT antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL
Sequence Length
443
Applicable Applications for anti-EOGT antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human C3orf64
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-C3orf64 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Western Blot (WB)
(WB Suggested Anti-C3orf64 Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Related Product Information for anti-EOGT antibody
This is a rabbit polyclonal antibody against C3orf64. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The exact function of C3orf64 remains unknown.
Target Description: The exact function of C3orf64 remains unknown.
Product Categories/Family for anti-EOGT antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
EGF domain-specific O-linked N-acetylglucosamine transferase isoform b
NCBI Official Synonym Full Names
EGF domain specific O-linked N-acetylglucosamine transferase
NCBI Official Symbol
EOGT
NCBI Official Synonym Symbols
AOS4; AER61; EOGT1; C3orf64
NCBI Protein Information
EGF domain-specific O-linked N-acetylglucosamine transferase
UniProt Protein Name
EGF domain-specific O-linked N-acetylglucosamine transferase
Protein Family
UniProt Gene Name
EOGT
UniProt Synonym Gene Names
AER61; C3orf64; EOGT1
UniProt Entry Name
EOGT_HUMAN
NCBI Description
This gene encodes an enzyme that acts in the lumen of the endoplasmic reticulum to catalyze the transfer of N-acetylglucosamine to serine or threonine residues of extracellular-targeted proteins. This enzyme modifies proteins containing eukaryotic growth factor (EGF)-like domains, including the Notch receptor, thereby regulating developmental signalling. Mutations in this gene have been observed in individuals with Adams-Oliver syndrome 4. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]
Research Articles on EOGT
Similar Products
Product Notes
The EOGT eogt (Catalog #AAA3209328) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C3orf64 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's C3orf64 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EOGT eogt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GHHPTLGEHP KFTNYSFDVE EFMYLVLQAA DHVLQHPKWP FKKKHDEL. It is sometimes possible for the material contained within the vial of "C3orf64, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
