Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (C3ORF39 antibody (MBS5302719) used at 1.25 ug/ml to detect target protein.)

Rabbit C3ORF39 Polyclonal Antibody | anti-C3ORF39 antibody

C3ORF39 antibody

Gene Names
POMGNT2; AGO61; GTDC2; MDDGA8; C3orf39
Reactivity
Human, Mouse, Rat, Dog
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
C3ORF39; Polyclonal Antibody; C3ORF39 antibody; Polyclonal C3ORF39; Anti-C3ORF39; Chromosome ORF-3; FLJ14566; Chromosome ORF 3; Chromosome 3 ORF; AGO61; anti-C3ORF39 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog
Clonality
Polyclonal
Specificity
C3ORF39 antibody was raised against the middle region of C3Orf39
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of C3ORF39 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
580
Applicable Applications for anti-C3ORF39 antibody
Western Blot (WB)
Application Notes
WB: 1.25 ug/ml
Biological Significance
The function of Chromosome 3 ORF protein is not widely studied, and is yet to be elucidated fully.
Cross-Reactivity
Human,Mouse,Rat,Dog
Immunogen
C3ORF39 antibody was raised using the middle region of C3Orf39 corresponding to a region with amino acids TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPEN
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(C3ORF39 antibody (MBS5302719) used at 1.25 ug/ml to detect target protein.)

Western Blot (WB) (C3ORF39 antibody (MBS5302719) used at 1.25 ug/ml to detect target protein.)
Related Product Information for anti-C3ORF39 antibody
Rabbit polyclonal C3ORF39 antibody raised against the middle region of C3Orf39
Product Categories/Family for anti-C3ORF39 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
66 kDa (MW of target protein)
NCBI Official Full Name
chromosome 3 open reading frame 39, isoform CRA_a
NCBI Official Synonym Full Names
protein O-linked mannose N-acetylglucosaminyltransferase 2 (beta 1,4-)
NCBI Official Symbol
POMGNT2
NCBI Official Synonym Symbols
AGO61; GTDC2; MDDGA8; C3orf39
NCBI Protein Information
protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2
UniProt Protein Name
Protein O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2
UniProt Gene Name
POMGNT2
UniProt Synonym Gene Names
AGO61; C3orf39; EOGTL; GTDC2; POMGnT2
UniProt Entry Name
PMGT2_HUMAN

NCBI Description

This gene encodes a protein with glycosyltransferase activity although its function is not currently known. [provided by RefSeq, Sep 2012]

Uniprot Description

AGO61: a protein with glycosyltransferase activity although its function is not currently known. [provided by RefSeq, Sep 2012]

Protein type: EC 2.4.1.255; Transferase; Secreted, signal peptide; EC 2.4.-.-; Secreted

Chromosomal Location of Human Ortholog: 3p22.1

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane

Molecular Function: acetylglucosaminyltransferase activity

Biological Process: protein amino acid O-linked glycosylation; protein amino acid O-linked mannosylation; neuron migration

Disease: Muscular Dystrophy-dystroglycanopathy (congenital With Brain And Eye Anomalies), Type A, 8

Research Articles on C3ORF39

Similar Products

Product Notes

The C3ORF39 pomgnt2 (Catalog #AAA5302719) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C3ORF39 antibody reacts with Human, Mouse, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's C3ORF39 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1.25 ug/ml. Researchers should empirically determine the suitability of the C3ORF39 pomgnt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C3ORF39, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.