Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-C3orf15 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Rabbit C3orf15 Polyclonal Antibody | anti-MAATS1 antibody

C3orf15 antibody - N-terminal region

Gene Names
MAATS1; AAT1; CFAP91; C3orf15; CaM-IP2; SPATA26; AAT1alpha
Reactivity
Horse, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C3orf15; Polyclonal Antibody; C3orf15 antibody - N-terminal region; anti-MAATS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IHYPRYSLYWSKSDPVPPFISREWKGHKEKHREALRQLTTTDASFQMPKE
Sequence Length
767
Applicable Applications for anti-MAATS1 antibody
Western Blot (WB)
Homology
Horse: 79%; Human: 100%; Rabbit: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-C3orf15 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)

Western Blot (WB) (WB Suggested Anti-C3orf15 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
Related Product Information for anti-MAATS1 antibody
This is a rabbit polyclonal antibody against C3orf15. It was validated on Western Blot

Target Description: Isoform 4 of C3orf15 may play a role in spermatogenesis.
Product Categories/Family for anti-MAATS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
cilia- and flagella-associated protein 91 isoform 1
NCBI Official Synonym Full Names
MYCBP associated and testis expressed 1
NCBI Official Symbol
MAATS1
NCBI Official Synonym Symbols
AAT1; CFAP91; C3orf15; CaM-IP2; SPATA26; AAT1alpha
NCBI Protein Information
cilia- and flagella-associated protein 91
UniProt Protein Name
Cilia- and flagella-associated protein 91
Protein Family
UniProt Gene Name
MAATS1
UniProt Synonym Gene Names
AAT-1

Uniprot Description

May regulate cilium motility through its role in the assembly of the axonemal radial spokes.

Research Articles on MAATS1

Similar Products

Product Notes

The MAATS1 maats1 (Catalog #AAA3215623) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C3orf15 antibody - N-terminal region reacts with Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's C3orf15 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAATS1 maats1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IHYPRYSLYW SKSDPVPPFI SREWKGHKEK HREALRQLTT TDASFQMPKE. It is sometimes possible for the material contained within the vial of "C3orf15, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.