Western Blot (WB)
(Western Blot analysis of C3AR1 expression in human liver using 124131.)
Rabbit anti-Human C3aR Polyclonal Antibody | anti-C3aR antibody
C3aR (C3a Anaphylatoxin Chemotactic Receptor, C3a-R, C3AR1, AZ3B, C3R1, HNFAG09) (MaxLight 650)
Gene Names
C3AR1; AZ3B; C3AR; HNFAG09
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
C3aR; Polyclonal Antibody; C3aR (C3a Anaphylatoxin Chemotactic Receptor; C3a-R; C3AR1; AZ3B; C3R1; HNFAG09) (MaxLight 650); anti-C3aR antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human C3AR1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-C3aR antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length protein corresponding to aa1-482 from human C3AR1.
Immunogen Sequence
MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDRCLVVFKPIWCQNHRNVGMACSICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSSSLDYPDFYGDPLENRSLENIVQPPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSADSLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHETSPLDNSDAFLSTHLKLFPSASSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSVIMIACYSFIVFRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVCIALASANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCPSNNVISERNSTTV
Conjugate
MaxLight650
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of C3AR1 expression in human liver using 124131.)
Western Blot (WB)
(Western Blot analysis of C3AR1 expression in human liver using 124131.)
Western Blot (WB)
(Western Blot analysis of C3AR1 expression in transfected 293T cell line by 124131. Lane 1: C3AR1 transfected lysate (53.9kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of C3AR1 expression in transfected 293T cell line by 124131. Lane 1: C3AR1 transfected lysate (53.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-C3aR antibody
C3a is an anaphylatoxin generated through activation of the complement C3. C3a is a potent chemoattractant for phagocytes, and it stimulates chemotaxis and other leukocyte functions. C3a binds to eosinophils, basophils, neutrophils, and differentiated U937 cells, that all express receptors for C3a on their cell surface. The C3a receptor has been cloned and shown to be a G protein-coupled receptor with seven putative transmembrane domains. This receptor is characterized for its large extracellular loop between the fourth and fifth transmembrane domains. The loop can be readily detected using the rabbit anti-C3a receptor antibody.
Product Categories/Family for anti-C3aR antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
53,864 Da
NCBI Official Full Name
C3a anaphylatoxin chemotactic receptor
NCBI Official Synonym Full Names
complement component 3a receptor 1
NCBI Official Symbol
C3AR1
NCBI Official Synonym Symbols
AZ3B; C3AR; HNFAG09
NCBI Protein Information
C3a anaphylatoxin chemotactic receptor; C3a-R; complement component 3 receptor 1
UniProt Protein Name
C3a anaphylatoxin chemotactic receptor
UniProt Gene Name
C3AR1
UniProt Synonym Gene Names
AZ3B; C3R1; HNFAG09; C3AR; C3a-R
UniProt Entry Name
C3AR_HUMAN
Uniprot Description
C3aR: Receptor for the chemotactic and inflammatory peptide anaphylatoxin C3a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production. Belongs to the G-protein coupled receptor 1 family.
Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral
Chromosomal Location of Human Ortholog: 12p13.31
Cellular Component: integral to plasma membrane; plasma membrane
Molecular Function: G-protein coupled receptor activity; C3a anaphylatoxin receptor activity; complement component C3a receptor activity; phosphoinositide phospholipase C activity
Biological Process: G-protein coupled receptor protein signaling pathway; positive regulation of angiogenesis; elevation of cytosolic calcium ion concentration; blood circulation; metabolic process; complement receptor mediated signaling pathway; inflammatory response; chemotaxis
Research Articles on C3aR
Similar Products
Product Notes
The C3aR c3ar1 (Catalog #AAA6371692) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C3aR (C3a Anaphylatoxin Chemotactic Receptor, C3a-R, C3AR1, AZ3B, C3R1, HNFAG09) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C3aR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the C3aR c3ar1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C3aR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
