Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (C20ORF111 antibody (MBS839055) used at 1 ug/ml to detect target protein.)

Rabbit C20ORF111 Polyclonal Antibody | anti-C20ORF111 antibody

C20ORF111 antibody

Gene Names
OSER1; Osr1; Perit1; HSPC207; C20orf111; dJ1183I21.1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
C20ORF111; Polyclonal Antibody; C20ORF111 antibody; Polyclonal C20ORF111; Anti-C20ORF111; Chromosome ORF-20; Chromosome ORF 20; HSPC207; Chromosome 20 ORF; dJ1183I21.1; Perit1; anti-C20ORF111 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
C20ORF111 antibody was raised against the N terminal Of C20Orf111
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C20ORF111 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
267
Applicable Applications for anti-C20ORF111 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of Chromosome 20 ORF protein is not widely studied, and is yet to be elucidated fully.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
C20ORF111 antibody was raised using the N terminal Of C20Orf111 corresponding to a region with amino acids RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSG
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(C20ORF111 antibody (MBS839055) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (C20ORF111 antibody (MBS839055) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C20ORF111 antibody
Rabbit polyclonal C20ORF111 antibody raised against the N terminal Of C20Orf111
Product Categories/Family for anti-C20ORF111 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
32 kDa (MW of target protein)
NCBI Official Full Name
chromosome 20 open reading frame 111, isoform CRA_b
NCBI Official Synonym Full Names
oxidative stress responsive serine-rich 1
NCBI Official Symbol
OSER1
NCBI Official Synonym Symbols
Osr1; Perit1; HSPC207; C20orf111; dJ1183I21.1
NCBI Protein Information
oxidative stress-responsive serine-rich protein 1
UniProt Protein Name
Oxidative stress-responsive serine-rich protein 1
UniProt Gene Name
OSER1
UniProt Synonym Gene Names
C20orf111
UniProt Entry Name
OSER1_HUMAN

Uniprot Description

OSER1:

Chromosomal Location of Human Ortholog: 20q13.11

Similar Products

Product Notes

The C20ORF111 oser1 (Catalog #AAA839055) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C20ORF111 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C20ORF111 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C20ORF111 oser1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C20ORF111, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.