Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: C1QL3Sample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human C1QL3 Polyclonal Antibody | anti-C1QL3 antibody

C1QL3 Antibody - middle region

Gene Names
C1QL3; C1ql; K100; CTRP13; C1QTNF13
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C1QL3; Polyclonal Antibody; C1QL3 Antibody - middle region; anti-C1QL3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFF
Sequence Length
255
Applicable Applications for anti-C1QL3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human C1QL3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: C1QL3Sample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: C1QL3Sample Type: A549 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-C1QL3 antibody
This is a rabbit polyclonal antibody against C1QL3. It was validated on Western Blot

Target Description: C1QL3 may regulate the number of excitatory synapses that are formed on hippocampus neurons. It has no effect on inhibitory synapses . It plays a role in glucose homeostasis. Via AMPK signaling pathway, C1QL3 stimulates glucose uptake in adipocytes, myotubes and hepatocytes and enhances insulin-stimulated glucose uptake. In a hepatoma cell line, C1QL3 reduces the expression of gluconeogenic enzymes G6PC and PCK1 and hence decreases de novo glucose production.
Product Categories/Family for anti-C1QL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
complement C1q-like protein 3
NCBI Official Synonym Full Names
complement C1q like 3
NCBI Official Symbol
C1QL3
NCBI Official Synonym Symbols
C1ql; K100; CTRP13; C1QTNF13
NCBI Protein Information
complement C1q-like protein 3
UniProt Protein Name
Complement C1q-like protein 3
UniProt Gene Name
C1QL3
UniProt Synonym Gene Names
CTRP13; C1q/TNF-related protein 13

Uniprot Description

May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses (). Plays a role in glucose homeostasis. Via AMPK signaling pathway, stimulates glucose uptake in adipocytes, myotubes and hepatocytes and enhances insulin-stimulated glucose uptake. In a hepatoma cell line, reduces the expression of gluconeogenic enzymes G6PC and PCK1 and hence decreases de novo glucose production ().

Research Articles on C1QL3

Similar Products

Product Notes

The C1QL3 c1ql3 (Catalog #AAA3217692) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C1QL3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's C1QL3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the C1QL3 c1ql3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VPKIAFYAGL KRQHEGYEVL KFDDVVTNLG NHYDPTTGKF TCSIPGIYFF. It is sometimes possible for the material contained within the vial of "C1QL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.