Western Blot (WB)
(C19ORF56 antibody (MBS5302280) used at 1 ug/ml to detect target protein.)
Rabbit C19ORF56 Polyclonal Antibody | anti-C19ORF56 antibody
C19ORF56 antibody
Gene Names
WDR83OS; PTD008; C19orf56
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
C19ORF56; Polyclonal Antibody; C19ORF56 antibody; Polyclonal C19ORF56; Anti-C19ORF56; Chromosome ORF 19; Chromosome ORF-19; Chromosome 19 ORF; PTD008; anti-C19ORF56 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
C19ORF56 antibody was raised against the N terminal Of C19Orf56
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C19ORF56 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
104
Applicable Applications for anti-C19ORF56 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of C19orf56 protein has not been widely studied, and is yet to be fully elucidated.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
C19ORF56 antibody was raised using the N terminal Of C19Orf56 corresponding to a region with amino acids STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(C19ORF56 antibody (MBS5302280) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(C19ORF56 antibody (MBS5302280) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C19ORF56 antibody
Rabbit polyclonal C19ORF56 antibody raised against the N terminal Of C19Orf56
Product Categories/Family for anti-C19ORF56 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
12 kDa (MW of target protein)
NCBI Official Full Name
C19orf56 protein, partial
NCBI Official Synonym Full Names
WD repeat domain 83 opposite strand
NCBI Official Symbol
WDR83OS
NCBI Official Synonym Symbols
PTD008; C19orf56
NCBI Protein Information
protein Asterix
UniProt Protein Name
Protein Asterix
UniProt Gene Name
WDR83OS
UniProt Synonym Gene Names
C19orf56
UniProt Entry Name
ASTER_HUMAN
Uniprot Description
WDR83OS: Belongs to the Asterix family.
Protein type: Membrane protein, multi-pass; Membrane protein, integral
Chromosomal Location of Human Ortholog: 19p13.2
Cellular Component: integral to membrane
Similar Products
Product Notes
The C19ORF56 wdr83os (Catalog #AAA5302280) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C19ORF56 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C19ORF56 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C19ORF56 wdr83os for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C19ORF56, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
