Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: C17ORF97Sample Tissue: Human Liver TumorAntibody Dilution: 1ug/ml)

Rabbit C17orf97 Polyclonal Antibody | anti-C17ORF97 antibody

C17orf97 Antibody

Gene Names
C17orf97; CK20; LIAT1
Reactivity
Dog, Horse, Human, Mouse, Rat
Purity
Affinity Purified
Synonyms
C17orf97; Polyclonal Antibody; C17orf97 Antibody; anti-C17ORF97 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GFHPDPEALKGFHTDPNAEEAPENLPYLSDKDGSSSHRQPTSKAECPNLC
Sequence Length
453
Homology
Dog: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Rat: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the following sequence GFHPDPEALKGFHTDPNAEEAPENLPYLSDKDGSSSHRQPTSKAECPNLC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: C17ORF97Sample Tissue: Human Liver TumorAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: C17ORF97Sample Tissue: Human Liver TumorAntibody Dilution: 1ug/ml)
Related Product Information for anti-C17ORF97 antibody
chromosome 17 open reading frame 97
Product Categories/Family for anti-C17ORF97 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50 kDa
NCBI Official Full Name
protein LIAT1
NCBI Official Synonym Full Names
chromosome 17 open reading frame 97
NCBI Official Symbol
C17orf97
NCBI Official Synonym Symbols
CK20; LIAT1
NCBI Protein Information
protein LIAT1
UniProt Protein Name
Uncharacterized protein C17orf97
UniProt Gene Name
C17orf97
UniProt Entry Name
CQ097_HUMAN

Similar Products

Product Notes

The C17ORF97 c17orf97 (Catalog #AAA3211665) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C17orf97 Antibody reacts with Dog, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: GFHPDPEALK GFHTDPNAEE APENLPYLSD KDGSSSHRQP TSKAECPNLC. It is sometimes possible for the material contained within the vial of "C17orf97, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.