Western Blot (WB)
(C10ORF56 antibody (MBS839493) used at 1 ug/ml to detect target protein.)
Rabbit C10ORF56 Polyclonal Antibody | anti-C10ORF56 antibody
C10ORF56 antibody
Gene Names
ZCCHC24; Z3CXXC8; C10orf56
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
C10ORF56; Polyclonal Antibody; C10ORF56 antibody; Polyclonal C10ORF56; Anti-C10ORF56; Chromosome ORF-10; Chromosome ORF 10; Chromosome 10 ORF; FLJ90798; anti-C10ORF56 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
C10ORF56 antibody was raised against the middle region of C10Orf56
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C10ORF56 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
241
Applicable Applications for anti-C10ORF56 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
C10orf56 is probably involved in oxidoreductase activity.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
C10ORF56 antibody was raised using the middle region of C10Orf56 corresponding to a region with amino acids LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(C10ORF56 antibody (MBS839493) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(C10ORF56 antibody (MBS839493) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-C10ORF56 antibody
Rabbit polyclonal C10ORF56 antibody raised against the middle region of C10Orf56
Product Categories/Family for anti-C10ORF56 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
27 kDa (MW of target protein)
NCBI Official Full Name
chromosome 10 open reading frame 56, isoform CRA_a
NCBI Official Synonym Full Names
zinc finger, CCHC domain containing 24
NCBI Official Symbol
ZCCHC24
NCBI Official Synonym Symbols
Z3CXXC8; C10orf56
NCBI Protein Information
zinc finger CCHC domain-containing protein 24
UniProt Protein Name
Zinc finger CCHC domain-containing protein 24
UniProt Gene Name
ZCCHC24
UniProt Synonym Gene Names
C10orf56
UniProt Entry Name
ZCH24_HUMAN
Uniprot Description
ZCCHC24:
Chromosomal Location of Human Ortholog: 10q22.3
Molecular Function: zinc ion binding
Research Articles on C10ORF56
Similar Products
Product Notes
The C10ORF56 zcchc24 (Catalog #AAA839493) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C10ORF56 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C10ORF56 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the C10ORF56 zcchc24 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "C10ORF56, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
