Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of TSPO expression in transfected 293T cell line by TSPO polyclonal antibody. Lane 1: TSPO transfected lysate (18.8kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human BZRP Polyclonal Antibody | anti-TSPO antibody

BZRP (Translocator Protein, Peripheral-type Benzodiazepine Receptor, PBR, PKBS, Mitochondrial Benzodiazepine Receptor, MBR, TSPO)

Gene Names
TSPO; DBI; IBP; MBR; PBR; PBS; BPBS; BZRP; PKBS; PTBR; mDRC; pk18
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
BZRP; Polyclonal Antibody; BZRP (Translocator Protein; Peripheral-type Benzodiazepine Receptor; PBR; PKBS; Mitochondrial Benzodiazepine Receptor; MBR; TSPO); Anti -BZRP (Translocator Protein; anti-TSPO antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TSPO.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE
Applicable Applications for anti-TSPO antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human TSPO, aa1-169 (AAH01110.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of TSPO expression in transfected 293T cell line by TSPO polyclonal antibody. Lane 1: TSPO transfected lysate (18.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of TSPO expression in transfected 293T cell line by TSPO polyclonal antibody. Lane 1: TSPO transfected lysate (18.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-TSPO antibody
Present mainly in the mitochondrial compartment of peripheral tissues, the protein BZRP interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis.
Product Categories/Family for anti-TSPO antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
706
UniProt Accession #
Molecular Weight
18,828 Da
NCBI Official Full Name
BZRP
NCBI Official Synonym Full Names
translocator protein (18kDa)
NCBI Official Symbol
TSPO
NCBI Official Synonym Symbols
DBI; IBP; MBR; PBR; PBS; BPBS; BZRP; PKBS; PTBR; mDRC; pk18
NCBI Protein Information
translocator protein; mitochondrial benzodiazepine receptor; benzodiazepine peripheral binding site; peripheral-type benzodiazepine receptor
UniProt Protein Name
Translocator protein
Protein Family
UniProt Gene Name
TSPO
UniProt Synonym Gene Names
BZRP; MBR; PBR
UniProt Entry Name
TSPOA_HUMAN

NCBI Description

Present mainly in the mitochondrial compartment of peripheral tissues, the protein encoded by this gene interacts with some benzodiazepines and has different affinities than its endogenous counterpart. The protein is a key factor in the flow of cholesterol into mitochondria to permit the initiation of steroid hormone synthesis. Alternatively spliced transcript variants have been reported; one of the variants lacks an internal exon and is considered non-coding, and the other variants encode the same protein. [provided by RefSeq, Feb 2012]

Uniprot Description

TSPO: Responsible for the manifestation of peripheral-type benzodiazepine recognition sites and is most likely to comprise binding domains for benzodiazepines and isoquinoline carboxamides. May play a role in the transport of porphyrins and heme. Plays a role in the transport of cholesterol across mitochondrial membranes in steroidogenic cells. Belongs to the TspO/BZRP family. Interacts with BZRAP1. May interact with STAR. Interacts with MOST-1. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Mitochondrial; Receptor, misc.; Apoptosis

Chromosomal Location of Human Ortholog: 22q13.31

Cellular Component: mitochondrial outer membrane; nuclear membrane; intracellular membrane-bound organelle; mitochondrion; cytoplasm; integral to membrane

Molecular Function: androgen binding; benzodiazepine receptor activity; cholesterol binding

Biological Process: steroid metabolic process; apoptosis; positive regulation of apoptosis; regulation of steroid biosynthetic process; axon regeneration in the peripheral nervous system; anion transport; response to vitamin B1; synaptic transmission; behavioral response to pain; positive regulation of mitochondrial depolarization; protein targeting to mitochondrion; aging; response to drug; adrenal gland development; negative regulation of nitric oxide biosynthetic process; chloride transport; negative regulation of tumor necrosis factor production; response to testosterone stimulus; lipid transport; glial cell migration; response to manganese ion; cell proliferation; response to progesterone stimulus; regulation of cholesterol transport; positive regulation of calcium ion transport; steroid biosynthetic process; heme biosynthetic process

Research Articles on TSPO

Similar Products

Product Notes

The TSPO tspo (Catalog #AAA645045) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BZRP (Translocator Protein, Peripheral-type Benzodiazepine Receptor, PBR, PKBS, Mitochondrial Benzodiazepine Receptor, MBR, TSPO) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BZRP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the TSPO tspo for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAPPWVPAMG FTLAPSLGCF VGSRFVHGEG LRWYAGLQKP SWHPPHWVLG PVWGTLYSAM GYGSYLVWKE LGGFTEKAVV PLGLYTGQLA LNWAWPPIFF GARQMGWALV DLLLVSGAAA ATTVAWYQVS PLAARLLYPY LAWLAFATTL NYCVWRDNHG WHGGRRLPE. It is sometimes possible for the material contained within the vial of "BZRP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.